Prostaglandin I Synthase Polyclonal Antibody
Cayman Chemical Item Number 160640
Prostacyclin Synthase; PGIS; PGI Synthase
Description
Antigen:
bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)
·
Host:
rabbit
·
Application(s):
WB and IP; other applications not tested
·
Prostaglandin I synthase (PGIS) catalyzes the isomerization of PGH2 to PGI2. PGI2 (prostacyclin) is a potent vasodilator and inhibitor of platelet aggregation. PGIS is a membrane-bound hemoprotein localized primarily in endothelial cells.1 The cloned bovine and human enzymes contain 500 amino acids and a calculated molecular mass of 56,629 and 57,103, respectively.2,3,4 Northern blot analysis reveals that the mRNA for PGIS is expressed in a wide variety of human tissues and is particularly abundant in ovary, heart, skeletal muscle, lung, and prostate.2
1
DeWitt, D.L., and Smith, W.L. Purification of prostacyclin synthase from bovine aorta by immunoaffinity chromatography. Evidence that the enzyme is a hemoprotein. J Biol Chem 258 3285-3293 (1983).
2
Miyata, A., Hara, S., Yokoyama, C., et al. Molecular cloning and expression of human prostacyclin synthase. Biochem Biophys Res Commun 200 1728-1734 (1994).
3
Pereira, B., Wu, K.K., and Wang, L. Molecular cloning and characterization of bovine prostacyclin synthase. Biochem Biophys Res Commun 203 59-66 (1994).
4
Hara, S., Miyata, A., Yokoyama, C., et al. Isolation and molecular cloning of prostacyclin synthase from bovine endothelial cells. J Biol Chem 269 19897-19903 (1994).
| Synonyms |
- Prostacyclin Synthase
- PGIS
- PGI Synthase
|
| Formulation |
Peptide affinity-purified IgG |
| Stability |
1 year |
| Storage |
-20°C |
| Shipping |
Wet ice
in continental US; may vary elsewhere
|
| Specificity |
| Human PGIS |
+ |
| Bovine PGIS |
+ |
| Ovine PGIS |
+ |
| Rat PGIS |
- |
Show all 4
Hide all but first 3
|
Background Reading
DeWitt, D.L., and Smith, W.L. Purification of prostacyclin synthase from bovine aorta by immunoaffinity chromatography. Evidence that the enzyme is a hemoprotein. J Biol Chem 258 3285-3293 (1983).
Pereira, B., Wu, K.K., and Wang, L. Molecular cloning and characterization of bovine prostacyclin synthase. Biochem Biophys Res Commun 203 59-66 (1994).
Hara, S., Miyata, A., Yokoyama, C., et al. Isolation and molecular cloning of prostacyclin synthase from bovine endothelial cells. J Biol Chem 269 19897-19903 (1994).
Miyata, A., Hara, S., Yokoyama, C., et al. Molecular cloning and expression of human prostacyclin synthase. Biochem Biophys Res Commun 200 1728-1734 (1994).
Show all 4
Hide all but first 3
|
Pricing updated 2012-02-09.
Prices are subject to change without notice.
To ask for assistance with one of our products please contact a Technical Support Scientist.
Warning This product is not for human or veterinary use.
Downloads
Batch-specific Information
Login
to access batch-specific information
|