160640  Prostaglandin I Synthase Polyclonal Antibody

Prostacyclin Synthase; PGIS; PGI Synthase

• See below for pricing and ordering
• See analysis tools
• See more Immunoprecipitation; Western Blot; Antibodies; Atherosclerosis; Neuroscience

Chemical structure definitions are available for many Cayman products. See Chemical Structure Database for details.

Antigen: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT) · Host: rabbit · Application(s): WB and IP; other applications not tested · Prostaglandin I synthase (PGIS) catalyzes the isomerization of PGH2 to PGI2. PGI2 (prostacyclin) is a potent vasodilator and inhibitor of platelet aggregation. PGIS is a membrane-bound hemoprotein localized primarily in endothelial cells.1 The cloned bovine and human enzymes contain 500 amino acids and a calculated molecular mass of 56,629 and 57,103, respectively.2,3,4 Northern blot analysis reveals that the mRNA for PGIS is expressed in a wide variety of human tissues and is particularly abundant in ovary, heart, skeletal muscle, lung, and prostate.2
1  DeWitt, D.L., Smith, W.L. Purification of prostacyclin synthase from bovine aorta by immunoaffinity chromatography. Evidence that the enzyme is a hemoprotein. J Biol Chem 258 3285-3293 (1983).
2  Miyata, A., Hara, S., Yokoyama, C., et al. Molecular cloning and expression of human prostacyclin synthase. Biochem Biophys Res Commun 200 1728-1734 (1994).
3  Pereira, B., Wu, K.K., Wang, L. Molecular cloning and characterization of bovine prostacyclin synthase. Biochem Biophys Res Commun 203 59-66 (1994).
4  Hara, S., Miyata, A., Yokoyama, C., et al. Isolation and molecular cloning of prostacyclin synthase from bovine endothelial cells. J Biol Chem 269 19897-19903 (1994).


Purchase 160640 Prostaglandin I Synthase Polyclonal Antibody

Pricing is for North America only. Other customers should contact a distributor in their region.

This product is also available to buy in bulk quantities. Please contact our Sales Department for a quote or to purchase.

Cayman strives to be a reliable biochemical reagent vendor by providing the best possible products and services. To ask for assistance with one of our products please contact our Technical Help staff.

Warning This product is not for human or veterinary use.

Pricing updated 2010-03-12.
Prices are subject to change without notice.

  email: password: hide x LOGIN | REGISTER
Cayman Chemical
Topical Catalogs
Packed with articles, the latest products, and much more.

New
Eicosanoid

Allergy, Asthma, & Inflammation

Cancer

More...
Helping to make your research possible by providing quality biochemicals and assays for research in and much more.
toll free 800.364.9897
direct dial 734.971.3335
1180 East Ellsworth Road
Ann Arbor, Michigan 48108
USA
All contact info
© 2002-2010
Cayman Chemical