See personalized New Product recommendations! Get personalized New Product recommendations! Register or Login for personalized New Product recommendations!

Join us! · InformexUSA 2012 · New Orleans, Louisiana · February 14-17, 2012 · Booth 2514

Prostaglandin I Synthase Polyclonal Antibody

Cayman Chemical Item Number 160640

Prostacyclin Synthase; PGIS; PGI Synthase

See more

Description

Antigen: bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT) · Host: rabbit · Application(s): WB and IP; other applications not tested · Prostaglandin I synthase (PGIS) catalyzes the isomerization of PGH2 to PGI2. PGI2 (prostacyclin) is a potent vasodilator and inhibitor of platelet aggregation. PGIS is a membrane-bound hemoprotein localized primarily in endothelial cells.1 The cloned bovine and human enzymes contain 500 amino acids and a calculated molecular mass of 56,629 and 57,103, respectively.2,3,4 Northern blot analysis reveals that the mRNA for PGIS is expressed in a wide variety of human tissues and is particularly abundant in ovary, heart, skeletal muscle, lung, and prostate.2

1 DeWitt, D.L., and Smith, W.L. Purification of prostacyclin synthase from bovine aorta by immunoaffinity chromatography. Evidence that the enzyme is a hemoprotein. J Biol Chem 258 3285-3293 (1983).

2 Miyata, A., Hara, S., Yokoyama, C., et al. Molecular cloning and expression of human prostacyclin synthase. Biochem Biophys Res Commun 200 1728-1734 (1994).

3 Pereira, B., Wu, K.K., and Wang, L. Molecular cloning and characterization of bovine prostacyclin synthase. Biochem Biophys Res Commun 203 59-66 (1994).

4 Hara, S., Miyata, A., Yokoyama, C., et al. Isolation and molecular cloning of prostacyclin synthase from bovine endothelial cells. J Biol Chem 269 19897-19903 (1994).

Synonyms
  • Prostacyclin Synthase
  • PGIS
  • PGI Synthase
Formulation Peptide affinity-purified IgG
Stability 1 year
Storage -20°C
Shipping Wet ice in continental US; may vary elsewhere
Specificity
Human PGIS +
Bovine PGIS +
Ovine PGIS +
Rat PGIS -
Show all 4 Hide all but first 3

Background Reading

DeWitt, D.L., and Smith, W.L. Purification of prostacyclin synthase from bovine aorta by immunoaffinity chromatography. Evidence that the enzyme is a hemoprotein. J Biol Chem 258 3285-3293 (1983).

Pereira, B., Wu, K.K., and Wang, L. Molecular cloning and characterization of bovine prostacyclin synthase. Biochem Biophys Res Commun 203 59-66 (1994).

Hara, S., Miyata, A., Yokoyama, C., et al. Isolation and molecular cloning of prostacyclin synthase from bovine endothelial cells. J Biol Chem 269 19897-19903 (1994).

Miyata, A., Hara, S., Yokoyama, C., et al. Molecular cloning and expression of human prostacyclin synthase. Biochem Biophys Res Commun 200 1728-1734 (1994).

Show all 4 Hide all but first 3
Size Price Quantity Subtotal
500 µl $161.00 $0.00
Bulk Contact
Cart Total $0.00

This product is available in custom sizes and/or larger quantities.

Please contact our Sales Department for a quote or to purchase.

Pricing updated 2012-02-12. Prices are subject to change without notice.

To ask for assistance with one of our products please contact a Technical Support Scientist.

Warning This product is not for human or veterinary use.

Related Products

Prostaglandin I Synthase Blocking Peptide
Prostaglandin I Synthase Monoclonal Antibody (Clone isn-1)
Prostaglandin I Synthase (murine) Polyclonal Antibody

Downloads

Batch-specific Information

Login to access batch-specific information

Cayman Chemical is a manufacturer, supplier and vendor of biochemical reagents, assay kits, antibodies, and proteins.

Other Resources
Management Team Company Profile Company History ChemAssistant Tools FAQs Cayman Europe Cayman Pharma CaBRI Cayman Gear Press Releases Illustrations and Charts Key Research Area Posters Article Library Analysis Tools Conference Schedule Order Terms Browser Recommendation Privacy Statement Site Map

Cayman Chemical Company · 1180 East Ellsworth Road · Ann Arbor, Michigan 48108 · USA

Toll Free: (800) 364-9897 (USA and Canada Only) · Fax: (734) 971-3640

Copyright 2012 Cayman Chemical Company

Lost password?