Antigen: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · Host: rabbit · Application(s): WB · Apoptosis-inducing factor (AIF) is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis.^1,2 Apoptosis is a controlled process of cell death necessary for proper physiological development and maintenance. Loss of mitochondrial membrane potential results in the release of several proteins critical to the acceleration of apoptosis.³ When AIF is released from the mitochondrial intermembrane space it migrates to the nucleus to initiate chromatin condensation and DNA cleavage.^4,5,6 AIF is recognized by immunoblotting at 67 kDa in most tissues and cell lines.

1 Lorenzo, H.K., Susin, S.A., Penninger, J., et al. Apoptosis inducing factor (AIF): A phylogenetically old, caspase-independent effector of cell death. Cell Death Differ 6 516-524 (1999).

2 Joza, N., Susin, S.A., Daugas, E., et al. Essential role of the mitochondrial apoptosis-inducing factor in programmed cell death. Nature 410 549-554 (2001).

3 Green, D.R., and Reed, J.C. Mitochondria and apoptosis. Science 281 1309-1312 (1998).

4 Susin, S.A., Lorenzo, H.K., Zamzami, N., et al. Molecular characterization of mitochondrial apoptosis-inducing factor. Nature 397 441-446 (1999).

5 Susin, S.A., Zamzami, N., Castedo, M., et al. Bcl-2 inhibits the mitochondrial release of an apoptogenic protease. J Exp Med 184 1331-1341 (1996).

6 Daugas, E., Susin, S.A., Zamzami, N., et al. Mitochondrio-nuclear translocation of AIF in apoptosis and necrosis. FASEB J 14 729-739 (2000).

Green, D.R., and Reed, J.C. Mitochondria and apoptosis. Science 281 1309-1312 (1998).

Joza, N., Susin, S.A., Daugas, E., et al. Essential role of the mitochondrial apoptosis-inducing factor in programmed cell death. Nature 410 549-554 (2001).

Lorenzo, H.K., Susin, S.A., Penninger, J., et al. Apoptosis inducing factor (AIF): A phylogenetically old, caspase-independent effector of cell death. Cell Death Differ 6 516-524 (1999).

Susin, S.A., Zamzami, N., Castedo, M., et al. Bcl-2 inhibits the mitochondrial release of an apoptogenic protease. J Exp Med 184 1331-1341 (1996).

Daugas, E., Susin, S.A., Zamzami, N., et al. Mitochondrio-nuclear translocation of AIF in apoptosis and necrosis. FASEB J 14 729-739 (2000).

Susin, S.A., Lorenzo, H.K., Zamzami, N., et al. Molecular characterization of mitochondrial apoptosis-inducing factor. Nature 397 441-446 (1999).

Show all 6 Hide all but first 3