360640  Prostaglandin I Synthase Blocking Peptide

Prostacyclin Synthase; PGIS; PGI Synthase


Chemical structure definitions are available for many Cayman products. See Chemical Structure Database for details.

Peptide sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.


Purchase 360640 Prostaglandin I Synthase Blocking Peptide

Pricing is for North America only. Other customers should contact a distributor in their region.

This product is also available to buy in bulk quantities. Please contact our Sales Department for a quote or to purchase.

Cayman strives to be a reliable biochemical reagent vendor by providing the best possible products and services. To ask for assistance with one of our products please contact our Technical Help staff.

Warning This product is not for human or veterinary use.

Pricing updated 2010-03-19.
Prices are subject to change without notice.

  email: password: hide x LOGIN | REGISTER
Cayman Chemical
Topical Catalogs
Packed with articles, the latest products, and much more.

New
Eicosanoid


Allergy, Asthma, & Inflammation

Cancer

More...
Helping to make your research possible by providing quality biochemicals and assays for research in and much more.
toll free 800.364.9897
direct dial 734.971.3335
1180 East Ellsworth Road
Ann Arbor, Michigan 48108
USA