AIF Blocking Peptide
Cayman Chemical Item Number 360773
Apoptosis-Inducing Factor; Programmed Cell Death Protein 8
Description
Each vial contains 200 µg of lyophilized peptide derived from the human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW). This peptide was used as an antigen for production of Cayman’s AIF polyclonal antibody (Catalog No. 160773) and can be used in conjunction with this antibody to block protein-antibody complex formation during analysis for AIF · Apoptosis-inducing factor (AIF) is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis.1,2 Apoptosis is a controlled process of cell death necessary for proper physiological development and maintenance. Loss of mitochondrial membrane potential results in the release of several proteins critical to the acceleration of apoptosis.3 When AIF is released from the mitochondrial intermembrane space it migrates to the nucleus to initiate chromatin condensation and DNA cleavage.4,5,6 AIF is recognized by immunoblotting at 67 kDa in most tissues and cell lines.
1
Lorenzo, H.K., Susin, S.A., Penninger, J., et al. Apoptosis inducing factor (AIF): A phylogenetically old, caspase-independent effector of cell death. Cell Death Differ 6 516-524 (1999).
2
Joza, N., Susin, S.A., Daugas, E., et al. Essential role of the mitochondrial apoptosis-inducing factor in programmed cell death. Nature 410 549-554 (2001).
3
Green, D.R., and Reed, J.C. Mitochondria and apoptosis. Science 281 1309-1312 (1998).
4
Susin, S.A., Lorenzo, H.K., Zamzami, N., et al. Molecular characterization of mitochondrial apoptosis-inducing factor. Nature 397 441-446 (1999).
5
Susin, S.A., Zamzami, N., Castedo, M., et al. Bcl-2 inhibits the mitochondrial release of an apoptogenic protease. J Exp Med 184 1331-1341 (1996).
6
Daugas, E., Susin, S.A., Zamzami, N., et al. Mitochondrio-nuclear translocation of AIF in apoptosis and necrosis. FASEB J 14 729-739 (2000).
| Synonyms |
- Apoptosis-Inducing Factor
- Programmed Cell Death Protein 8
|
| Formulation |
200 µg lyophilized peptide |
| Stability |
2 years |
| Storage |
-20°C |
| Shipping |
Wet ice
in continental US; may vary elsewhere
|
Background Reading
Green, D.R., and Reed, J.C. Mitochondria and apoptosis. Science 281 1309-1312 (1998).
Daugas, E., Susin, S.A., Zamzami, N., et al. Mitochondrio-nuclear translocation of AIF in apoptosis and necrosis. FASEB J 14 729-739 (2000).
Susin, S.A., Zamzami, N., Castedo, M., et al. Bcl-2 inhibits the mitochondrial release of an apoptogenic protease. J Exp Med 184 1331-1341 (1996).
Susin, S.A., Lorenzo, H.K., Zamzami, N., et al. Molecular characterization of mitochondrial apoptosis-inducing factor. Nature 397 441-446 (1999).
Lorenzo, H.K., Susin, S.A., Penninger, J., et al. Apoptosis inducing factor (AIF): A phylogenetically old, caspase-independent effector of cell death. Cell Death Differ 6 516-524 (1999).
Joza, N., Susin, S.A., Daugas, E., et al. Essential role of the mitochondrial apoptosis-inducing factor in programmed cell death. Nature 410 549-554 (2001).
Show all 6
Hide all but first 3
|
Pricing updated 2012-02-12.
Prices are subject to change without notice.
To ask for assistance with one of our products please contact a Technical Support Scientist.
Warning This product is not for human or veterinary use.
Downloads
Batch-specific Information
Login
to access batch-specific information
|