Anti-EP4 Receptor (C-Term):SureLight® APC | Cayman Chemical
We collect cookies for vital website function and to better serve our customers. By continuing to browse you agree to the storing of cookies on your device. See our privacy policy for details.

Anti-EP4 Receptor (C-Term):SureLight® APC

Item № 16625
     50 µg $336.00 0.00

Pricing updated 2018-11-19. Prices are subject to change without notice.

This product has been produced by

Anti-EP4 (Prostaglandin E4) receptor (C-term) conjugated to SureLight® APC

Antibody: Rabbit anti-EP4 receptor (C-term) IgG
Specificity: EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
Reactivity: Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested.
Dye: SureLight® Allophycocyanin (APC)
Excitation max. λ: 650 nm
Emission max. λ: 660 nm
Uses: Flow cytometry and cell-based assays

Recommended Products

Related Products
View Related Product Categories
Technical Information

Warning - this product is not for human or veterinary use.

Shipping & Storage
2°C to 8°C
Wet ice in continental US; may vary elsewhere
≥ 3 months
Downloads & Resources
Product Downloads

Download Product Insert

Download free InChI Key generation software

Additional Information

View the Cayman Structure Database for chemical structure definitions for many Cayman products

Get Batch-Specific Data and Documents by Batch Number

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data pack, and GC-MS data.

Technical Support
Contact Us
  • Toll Free Phone (USA and Canada Only): (888) 526-5351
  • Direct Phone: (734) 975-3888
Cayman Contract Services

We work with scientists to accelerate their research, drug discovery, and drug development needs through our expertise in the following areas:

Cayman Chemical

1180 East Ellsworth Road

Ann Arbor, Michigan 48108 USA

Toll Free: (800) 364-9897

(USA and Canada Only)

Fax: (734) 971-3640