Anti-EP4 Receptor (C-Term):SureLight® APC

Item № 16625
SIZE PRICE QUANTITY SUBTOTAL
CART TOTAL $0.00
50 µg $329.00 0.00

Pricing updated 2018-02-18. Prices are subject to change without notice.

This product has been produced by
Description


Anti-EP4 (Prostaglandin E4) receptor (C-term) conjugated to SureLight® APC

Antibody: Rabbit anti-EP4 receptor (C-term) IgG
Specificity: EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
Reactivity: Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested.
Dye: SureLight® Allophycocyanin (APC)
Excitation max. λ: 650 nm
Emission max. λ: 660 nm
Uses: Flow cytometry and cell-based assays

Recommended Products

Related Products
View Related Product Categories
Technical Information
Formulation
Lyophilized

Warning - this product is not for human or veterinary use.

Shipping & Storage
Storage
2°C to 8°C
Shipping
Wet ice in continental US; may vary elsewhere
Stability
≥ 3 months
Downloads & Resources
Product Downloads

Download free InChI Key generation software

Additional Information

View the Cayman Structure Database for chemical structure definitions for many Cayman products

Get Batch-Specific Data and Documents by Batch Number

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data pack, and GC-MS data.

Technical Support
Contact Us
  • Toll Free Phone (USA and Canada Only): (888) 526-5351
  • Direct Phone: (734) 975-3888
Contract Research Services

We work with scientists to support their research, drug discovery, and drug development needs through our expertise in the following research services:

Cayman Chemical

1180 East Ellsworth Road

Ann Arbor, Michigan 48108 USA

Toll Free: (800) 364-9897

(USA and Canada Only)

Fax: (734) 971-3640