A citrullinated form of Aβ40
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Citrullinated Amyloid-β (1-40) Peptide (human)

Item No. 30985

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Synonyms
  • Citrullinated Aβ (1-40)
  • Citrullinated Aβ40
  • R5C1-40
Formulation (Request formulation change)
1,000 µg of lyophilized peptide
Peptide Sequence
DAEFXHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (X=Citrulline)
UniProt Accession №
P05067
Shipping & Storage Information
Storage
-20°C
Shipping
Wet ice in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $267

    Add
    Product Description

    Amyloid-β (1-40) (Aβ40) peptide is a 40-amino acid protein fragment of Aβ42 (Item No. 20574), a neurotoxic peptide found in amyloid plaques in postmortem cerebral cortex from patients with Alzheimer's disease.1,2 Aβ40 is more abundant, less neurotoxic, and does not form oligomers as easily as Aβ42.3,4 Citrullinated Aβ40 is a modified form of Aβ40 (Item No. 21617) that is citrullinated at arginine 5.5 It exhibits increased transient formation of soluble oligomers and insoluble aggregates composed of distorted parallel β-sheets compared with unmodified Aβ40, which forms fibrils composed of parallel β-sheets.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Wolfe, M.S. Therapeutic strategies for Alzheimer’s disease. Nat. Rev. Drug Discov. 1(11), 859-866 (2002).

    2. Iwatsubo, T., Odaka, A., Suzuki, N., et al. Visualization of Aβ42(43) and Aβ40 in senile plaques with end-specific Aβ monoclonals: Evidence that an initially deposited species is Aβ42(43). Neuron 13(1), 45-53 (1994).

    3. Bitan, G., Kirkitadze, M.D., Lomakin, A., et al. Amyloid β-protein (Aβ) assembly: Aβ40 and Aβ42 oligomerize through distinct pathways. Proc. Natl. Acad. Sci. USA 100(1), 330-335 (2003).

    4. Murphy, M.P., and LeVine, H., III Alzheimer’s disease and the β-amyloid peptide. J. Alzheim. Dis. 19(1), 311 (2010).

    5. Osaki, D., and Hiramatsu, H. Citrullination and deamidation affect aggregation properties of amyloid β-proteins. Amyloid 23(4), 234-241 (2016).