A synthetic N-terminal fragment of PTH and an agonist of PTH1R and PTH2R
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Parathyroid Hormone (1-34) (rat) (acetate)

Item No. 36861

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-alanyl-L-valyl-L-seryl-L-α-glutamyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-methionyl-L-histidyl-L-asparaginyl-L-leucylglycyl-L-lysyl-L-histidyl-L-leucyl-L-alanyl-L-seryl-L-valyl-L-α-glutamyl-L-arginyl-L-methionyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-α-aspartyl-L-valyl-L-histidyl-L-asparaginyl-L-phenylalanine, acetate
Synonyms
  • PTH (1-34)
Molecular Formula
C180H291N55O48S2 • C2H4O2
Formula Weight
4117.8
Purity
≥95%
Formulation (Request formulation change)
A solid
Peptide Sequence
AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF-OH
Solubility(Learn about Variance in Solubility)
Water: Soluble
SMILES
C[C@@H](C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CCC(O)=O)C(N[C@@](C(N[C@@H](CCC(N)=O)C(N[C@H](C(N[C@@H](CCSC)C(N[C@@H](CC1=CNC=N1)C(N[C@@H](CC(N)=O)C(N[C@H](C(NCC(N[C@@H](CCCCN[H])C(N[C@@H](CC2=CNC=N2)C(N[C@H](C(N[C@H](C(N[C@@H](CO)C(N[C@@H](C(C)C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCSC)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC3=CNC4=C3C=CC=C4)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN[H])C(N[C@@H](CCCCN[H])C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CC5=CNC=N5)C(N[C@@H](CC(N)=O)C(N[C@H](C(O)=O)CC6=CC=CC=C6)=O)=O)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)=O)C)=O)CC(C)C)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)CC(C)C)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)N[H].CC(O)=O
InChi Code
InChI=1S/C180H291N55O48S2.C2H4O2/c1-23-96(18)145(235-160(264)115(50-55-140(246)247)212-172(276)131(83-236)231-176(280)142(93(12)13)232-146(250)97(19)184)177(281)216-113(48-53-135(187)240)157(261)219-121(68-91(8)9)164(268)214-117(57-64-285-22)159(263)224-125(73-102-80-195-86-202-102)167(271)225-127(75-136(188)241)169(273)217-118(65-88(2)3)148(252)200-82-138(243)205-106(41-29-32-58-181)149(253)223-124(72-101-79-194-85-201-101)166(270)220-119(66-89(4)5)161(265)204-98(20)147(251)230-132(84-237)173(277)234-143(94(14)15)174(278)215-114(49-54-139(244)245)154(258)208-109(44-35-61-197-179(190)191)152(256)213-116(56-63-284-21)158(262)210-111(46-51-133(185)238)155(259)222-123(71-100-78-199-105-40-28-27-39-104(100)105)165(269)221-122(69-92(10)11)162(266)209-110(45-36-62-198-180(192)193)151(255)206-107(42-30-33-59-182)150(254)207-108(43-31-34-60-183)153(257)218-120(67-90(6)7)163(267)211-112(47-52-134(186)239)156(260)227-129(77-141(248)249)171(275)233-144(95(16)17)175(279)228-126(74-103-81-196-87-203-103)168(272)226-128(76-137(189)242)170(274)229-130(178(282)283)70-99-37-25-24-26-38-99;1-2(3)4/h24-28,37-40,78-81,85-98,106-132,142-145,199,236-237H,23,29-36,41-77,82-84,181-184H2,1-22H3,(H2,185,238)(H2,186,239)(H2,187,240)(H2,188,241)(H2,189,242)(H,194,201)(H,195,202)(H,196,203)(H,200,252)(H,204,265)(H,205,243)(H,206,255)(H,207,254)(H,208,258)(H,209,266)(H,210,262)(H,211,267)(H,212,276)(H,213,256)(H,214,268)(H,215,278)(H,216,281)(H,217,273)(H,218,257)(H,219,261)(H,220,270)(H,221,269)(H,222,259)(H,223,253)(H,224,263)(H,225,271)(H,226,272)(H,227,260)(H,228,279)(H,229,274)(H,230,251)(H,231,280)(H,232,250)(H,233,275)(H,234,277)(H,235,264)(H,244,245)(H,246,247)(H,248,249)(H,282,283)(H4,190,191,197)(H4,192,193,198);1H3,(H,3,4)/t96-,97-,98-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,142-,143-,144-,145-;/m0./s1
InChi Key
KENQZKFSNOENCW-GYDTUBDISA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    500 µg

    $202

    Add

    1 mg

    $382

    Add

    5 mg

    $1,106

    Add
    Product Description

    Parathyroid hormone (PTH) (1-34) is a synthetic N-terminal fragment of PTH that corresponds to amino acids 1-34 of mature PTH and a PTH receptor agonist.1,2 It induces β-arrestin recruitment in HEK293H cells expressing human PTH receptor type 1 (PTH1R; EC50 = 7.7 nM) and adenylyl cyclase activation in COS-7 cells expressing rat PTH2R (EC50 = 0.41 nM). PTH (1-34) (100 nM) induces hypertrophy of primary rat ventricular cardiomyocytes.3 It increases tibial bone mineral density in ovariectomized rats when administered at a dose of 5 µg/kg.4

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Kim, B.H., Pereverzev, A., Zhu, S., et al. Extracellular nucleotides enhance agonist potency at the parathyroid hormone 1 receptor. Cell. Signal. 46, 103-112 (2018).

    2. Hoare, S.R., Bonner, T.I., and Usdin, T.B. Comparison of rat and human parathyroid hormone 2 (PTH2) receptor activation: PTH is a low potency partial agonist at the rat PTH2 receptor. Endocrinology 140(10), 4419-4425 (1999).

    3. Liu, X., Xie, R., and Liu, S. Rat parathyroid hormone 1-34 signals through the MEK/ERK pathway to induce cardiac hypertrophy. J. Int. Med. Res. 36(5), 942-950 (2008).

    4. Gowen, M., Stroup, G.B., Dodds, R.A., et al. Antagonizing the parathyroid calcium receptor stimulates parathyroid hormone secretion and bone formation in osteopenic rats. J. Clin. Invest. 105(11), 1595-1604 (2000).