An antimicrobial peptide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

BMAP 28 (bovine) (trifluoroacetate salt)

Item No. 36960

Technical Information
Formal Name
glycylglycyl-L-leucyl-L-arginyl-L-seryl-L-leucylglycyl-L-arginyl-L-lysyl-L-isoleucyl-L-leucyl-L-arginyl-L-alanyl-L-tryptophyl-L-lysyl-L-lysyl-L-tyrosylglycyl-L-prolyl-L-isoleucyl-L-isoleucyl-L-valyl-L-prolyl-L-isoleucyl-L-isoleucyl-L-arginyl-L-isoleucinamide, trifluoroacetate salt
Synonyms
  • Bovine Myeloid Antimicrobial Peptide 28
  • Cathelicidin-5 (132-158)
Molecular Formula
C145H250N44O29 • XCF3COOH
Formula Weight
Purity
≥95%
A solid
Peptide Sequence
GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2
Water: Soluble
SMILES
OC(C(F)(F)F)=O.[H]NCCCC[C@H](NC([C@H](CCCNC(N)=N)NC(CNC([C@@H](NC([C@H](CO)NC([C@H](CCCNC(N)=N)NC([C@@H](NC(CNC(CN[H])=O)=O)CC(C)C)=O)=O)=O)CC(C)C)=O)=O)=O)C(N[C@@](C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@@H](CC1=CNC2=C1C=CC=C2)C(N[C@@H](CCCCN[H])C(N[C@@H](CCCCN[H])C(N[C@@H](CC(C=C3)=CC=C3O)C(NCC(N4CCC[C@H]4C(N[C@@](C(N[C@@](C(N[C@@H](C(C)C)C(N5CCC[C@H]5C(N[C@@](C(N[C@@](C(N[C@@H](CCCNC(N)=N)C(N[C@@](C(N)=O)([H])[C@H](CC)C)=O)=O)([H])[C@H](CC)C)=O)([H])[C@H](CC)C)=O)=O)=O)([H])[C@H](CC)C)=O)([H])[C@H](CC)C)=O)=O)=O)=O)=O)=O)=O)C)=O)=O)CC(C)C)=O)([H])[C@H](CC)C)=O
InChi Code
InChI=1S/C145H250N44O29.C2HF3O2/c1-22-81(15)113(119(150)196)182-128(205)99(50-39-63-162-145(157)158)175-136(213)115(83(17)24-3)186-139(216)117(85(19)26-5)185-135(212)107-52-41-65-189(107)141(218)112(80(13)14)181-138(215)118(86(20)27-6)187-140(217)116(84(18)25-4)184-134(211)106-51-40-64-188(106)111(195)75-166-122(199)103(69-88-53-55-90(191)56-54-88)178-126(203)95(45-31-34-58-147)170-125(202)94(44-30-33-57-146)172-132(209)104(70-89-72-163-92-43-29-28-42-91(89)92)176-120(197)87(21)167-123(200)97(48-37-61-160-143(153)154)173-131(208)102(68-79(11)12)179-137(214)114(82(16)23-2)183-129(206)96(46-32-35-59-148)171-124(201)93(47-36-60-159-142(151)152)168-110(194)74-165-121(198)100(66-77(7)8)177-133(210)105(76-190)180-127(204)98(49-38-62-161-144(155)156)174-130(207)101(67-78(9)10)169-109(193)73-164-108(192)71-149;3-2(4,5)1(6)7/h28-29,42-43,53-56,72,77-87,93-107,112-118,163,190-191H,22-27,30-41,44-52,57-71,73-76,146-149H2,1-21H3,(H2,150,196)(H,164,192)(H,165,198)(H,166,199)(H,167,200)(H,168,194)(H,169,193)(H,170,202)(H,171,201)(H,172,209)(H,173,208)(H,174,207)(H,175,213)(H,176,197)(H,177,210)(H,178,203)(H,179,214)(H,180,204)(H,181,215)(H,182,205)(H,183,206)(H,184,211)(H,185,212)(H,186,216)(H,187,217)(H4,151,152,159)(H4,153,154,160)(H4,155,156,161)(H4,157,158,162);(H,6,7)/t81-,82-,83-,84-,85-,86-,87-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,112-,113-,114-,115-,116-,117-,118-;/m0./s1
InChi Key
VUDOLZSJPFRNHA-BVZWWGGDSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Cayman Chemical
    Neutrophil Biology Wall Poster

    Explore how neutrophils shape the immune response in health and disease. This poster highlights neutrophil pathogen defense mechanisms, including phagocytosis, degranulation, and NETosis, as well as neutrophil roles in inflammation and NET-associated pathologies.

    DOWNLOAD NOW
    Product Description

    Bovine myeloid antimicrobial peptide (BMAP) 28 is a synthetic antimicrobial peptide that corresponds to amino acids 132-158 of bovine cathelicidin-5.1 It is active against the bacteria E. coli, S. aureus, methicillin-resistant S. aureus (MRSA), and S. epidermidis and the fungus C. albicans (MICs = 2, 2, 4, 1, and 8 µM, respectively). BMAP 28 induces inner membrane permeabilization in E. coli when used at a concentration of 200 nM. It reduces viral replication of herpes simplex virus 1 (HSV-1) in Vero 76-infected cells when used at a concentration of 5 µM.2 It induces hemolysis of isolated human erythrocytes and is cytotoxic to isolated human neutrophils when used at a concentration of 30 µM.1 BMAP 28 (0.8 mg/kg) increases survival in E. coli- or MRSA-infected mice but not P. aeruginosa-infected mice.2

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Skerlavaj, B., Gennaro, R., Bagella, L., et al. Biological characterization of two novel cathelicidin-derived peptides and identification of structural requirements for their antimicrobial and cell lytic activities. The Journal of Biological Chemisty 271(45), 28375-28381 (1996).

    2. Benincasa, M., Skerlavaj, B., Gennaro, R., et al. In vitro and in vivo antimicrobial activity of two α-helical cathelicidin peptides and of their synthetic analogs. Peptides 24(11), 1723-1731 (2003).