A neuropeptide and PTH2R agonist
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

TIP39 (human, bovine) (trifluoroacetate salt)

Item No. 37452

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-seryl-L-leucyl-L-alanyl-L-leucyl-L-alanyl-L-α-aspartyl-L-α-aspartyl-L-alanyl-L-alanyl-L-phenylalanyl-L-arginyl-L-α-glutamyl-L-arginyl-L-alanyl-L-arginyl-L-leucyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-α-glutamyl-L-arginyl-L-arginyl-L-histidyl-L-tryptophyl-L-leucyl-L-asparaginyl-L-seryl-L-tyrosyl-L-methionyl-L-histidyl-L-lysyl-L-leucyl-L-leucyl-L-valyl-L-leucyl-L-α-aspartyl-L-alanyl-L-proline, trifluoroacetate salt
Synonyms
  • Tuberoinfundibular Peptide of 39 Residues
Molecular Formula
C202H325N61O54S • XCF3COOH
Formula Weight
4504.2
Purity
≥98%
Formulation (Request formulation change)
A solid
Peptide Sequence
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP-OH
Solubility(Learn about Variance in Solubility)
20% ACN/H2O: Soluble
SMILES
OC(C(F)(F)F)=O.O=C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC1=CNC=N1)C(N[C@@H](CC2=CNC3=C2C=CC=C3)C(N[C@H](C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H](CC4=CC=C(O)C=C4)C(N[C@@H](CCSC)C(N[C@@H](CC5=CNC=N5)C(N[C@@H](CCCCN[H])C(N[C@H](C(N[C@H](C(N[C@@H](C(C)C)C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@H](C(N6CCC[C@H]6C(O)=O)=O)C)=O)=O)CC(C)C)=O)=O)CC(C)C)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)CC(C)C)=O)C)=O)C)=O)CC(C)C)=O)CC(C)C)=O)=O)C)=O)=O)=O)=O)CC7=CC=CC=C7)=O)C)=O)C)=O)=O)=O)C)=O)CC(C)C)=O)C)=O)CC(C)C)[C@H](CO)N[H]
InChi Code
InChI=1S/C202H325N61O54S.C2HF3O2/c1-96(2)71-132(243-164(283)111(26)232-177(296)133(72-97(3)4)247-166(285)121(204)92-264)176(295)231-112(27)165(284)246-149(88-157(276)277)192(311)259-147(86-155(272)273)179(298)230-107(22)160(279)227-109(24)163(282)245-141(80-114-43-31-30-32-44-114)186(305)239-127(51-40-67-221-201(212)213)169(288)240-129(58-60-153(268)269)173(292)235-124(48-37-64-218-198(206)207)167(286)228-110(25)161(280)234-125(49-38-65-219-199(208)209)171(290)249-136(75-100(9)10)182(301)250-134(73-98(5)6)178(297)229-106(21)159(278)226-108(23)162(281)244-135(74-99(7)8)181(300)241-130(59-61-154(270)271)174(293)237-126(50-39-66-220-200(210)211)168(287)236-128(52-41-68-222-202(214)215)172(291)255-145(84-118-91-217-95-225-118)190(309)254-143(82-116-89-223-122-46-34-33-45-120(116)122)188(307)251-138(77-102(13)14)184(303)257-146(85-152(205)267)191(310)261-150(93-265)194(313)253-142(81-115-54-56-119(266)57-55-115)187(306)242-131(62-70-318-29)175(294)256-144(83-117-90-216-94-224-117)189(308)238-123(47-35-36-63-203)170(289)248-137(76-101(11)12)183(302)252-140(79-104(17)18)193(312)262-158(105(19)20)195(314)260-139(78-103(15)16)185(304)258-148(87-156(274)275)180(299)233-113(28)196(315)263-69-42-53-151(263)197(316)317;3-2(4,5)1(6)7/h30-34,43-46,54-57,89-91,94-113,121,123-151,158,223,264-266H,35-42,47-53,58-88,92-93,203-204H2,1-29H3,(H2,205,267)(H,216,224)(H,217,225)(H,226,278)(H,227,279)(H,228,286)(H,229,297)(H,230,298)(H,231,295)(H,232,296)(H,233,299)(H,234,280)(H,235,292)(H,236,287)(H,237,293)(H,238,308)(H,239,305)(H,240,288)(H,241,300)(H,242,306)(H,243,283)(H,244,281)(H,245,282)(H,246,284)(H,247,285)(H,248,289)(H,249,290)(H,250,301)(H,251,307)(H,252,302)(H,253,313)(H,254,309)(H,255,291)(H,256,294)(H,257,303)(H,258,304)(H,259,311)(H,260,314)(H,261,310)(H,262,312)(H,268,269)(H,270,271)(H,272,273)(H,274,275)(H,276,277)(H,316,317)(H4,206,207,218)(H4,208,209,219)(H4,210,211,220)(H4,212,213,221)(H4,214,215,222);(H,6,7)/t106-,107-,108-,109-,110-,111-,112-,113-,121-,123-,124-,125-,1
InChi Key
VATRRZYUCVOKRP-RMKIITJUSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $74

    Add

    5 mg

    $257

    Add

    10 mg

    $438

    Add
    Product Description

    TIP39 is a neuropeptide and parathyroid hormone receptor type 2 (PTH2R) agonist.1 It induces cAMP accumulation in COS-7 cells expressing recombinant human or rat PTH2R (EC50s = 0.5 and 0.8 nM, respectively) and F-11 cells that endogenously express PTH2R (EC50 = 1.15 nM). TIP39 (1 nM) induces cell cycle arrest at the G0/G1 phase and decreases expression of the master regulator of cartilage differentiation Sox9 in CFK2 rat chondrocytes.2 TIP39 (100 pmol/animal) decreases immobility time in the forced swim test in mice.3

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Usdin, T.B., Hoare, S.R., Wang, T., et al. TIP39: A new neuropeptide and PTH2-receptor agonist from hypothalamus. Nat. Neurosci. 2(11), 941-943 (1999).

    2. Panda, D., Goltzman, D., Jüppner, H., et al. TIP39/parathyroid hormone type 2 receptor signaling is a potent inhibitor of chondrocyte proliferation and differentiation. Am. J. Physiol. Endocrinol. Metab. 297(5), E1125-E1136 (2009).

    3. LaBuda, C.J., Dobolyi, A., and Usdin, T.B. Tuberoinfundibular peptide of 39 residues produces anxiolytic and antidepressant actions. Neuroreport 15(5), 881-885 (2004).