A cell-penetrating peptide and TRPA1 activator
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

WaTx (36-68) (scorpion) (trifluoroacetate salt)

Item No. 37495

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-alanyl-L-seryl-L-prolyl-L-glutaminyl-L-glutaminyl-L-alanyl-L-lysyl-L-tyrosyl-L-cysteinyl-L-tyrosyl-L-α-glutamyl-L-glutaminyl-L-cysteinyl-L-asparaginyl-L-valyl-L-asparaginyl-L-lysyl-L-valyl-L-prolyl-L-phenylalanyl-L-α-aspartyl-L-glutaminyl-L-cysteinyl-L-tyrosyl-L-glutaminyl-L-methionyl-L-cysteinyl-L-seryl-L-prolyl-L-leucyl-L-α-glutamyl-L-arginyl-L-serine, trifluoroacetate salt
Synonyms
  • Wasabi Receptor Toxin (36-68)
Molecular Formula
C164H245N45O53S5 • XCF3COOH
Formula Weight
3855.3
Purity
≥95%
Formulation (Request formulation change)
A solid
Peptide Sequence
ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS-OH
Solubility(Learn about Variance in Solubility)
Water: Soluble
SMILES
[H]N[C@H](C(N[C@@H](CO)C(N1CCC[C@H]1C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@H](C(N[C@@H](CCCCN)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(N)=O)C(N[C@H](C(N[C@@H](CC(N)=O)C(N[C@@H](C(C)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](C(C)C)C(N2CCC[C@H]2C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C3=O)=O)CC(O)=O)=O)CC4=CC=CC=C4)=O)=O)=O)=O)=O)=O)=O)CSSC[C@H](N3)C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@H](C5=O)CCSC)=O)=O)CC6=CC=C(O)C=C6)=O)=O)=O)=O)CC7=CC=C(O)C=C7)=O)CSSC[C@H](N5)C(N[C@@H](CO)C(N8CCC[C@H]8C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CO)C(O)=O)=O)=O)=O)=O)=O)=O)=O)CC9=CC=C(O)C=C9)=O)=O)C)=O)=O)=O)=O)=O)C.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C164H245N45O53S5.C2HF3O2/c1-78(2)63-101(144(242)186-98(46-53-126(223)224)138(236)180-92(25-17-58-177-164(175)176)135(233)200-111(73-212)163(261)262)195-157(255)117-27-19-60-208(117)161(259)110(72-211)199-155(253)115-77-267-266-76-114(204-148(246)104(67-86-33-39-89(215)40-34-86)190-134(232)90(23-13-15-56-165)179-132(230)82(8)178-133(231)93(41-48-119(168)216)182-137(235)97(45-52-123(172)220)189-156(254)116-26-18-59-207(116)160(258)109(71-210)198-131(229)81(7)167)153(251)192-103(66-85-31-37-88(214)38-32-85)146(244)187-99(47-54-127(225)226)139(237)183-95(43-50-121(170)218)140(238)202-113-75-265-264-74-112(152(250)191-102(65-84-29-35-87(213)36-30-84)145(243)184-94(42-49-120(169)217)136(234)188-100(55-62-263-9)142(240)203-115)201-141(239)96(44-51-122(171)219)185-150(248)108(70-128(227)228)194-147(245)105(64-83-21-11-10-12-22-83)196-158(256)118-28-20-61-209(118)162(260)130(80(5)6)206-143(241)91(24-14-16-57-166)181-149(247)106(68-124(173)221)197-159(257)129(79(3)4)205-151(249)107(69-125(174)222)193-154(113)252;3-2(4,5)1(6)7/h10-12,21-22,29-40,78-82,90-118,129-130,210-215H,13-20,23-28,41-77,165-167H2,1-9H3,(H2,168,216)(H2,169,217)(H2,170,218)(H2,171,219)(H2,172,220)(H2,173,221)(H2,174,222)(H,178,231)(H,179,230)(H,180,236)(H,181,247)(H,182,235)(H,183,237)(H,184,243)(H,185,248)(H,186,242)(H,187,244)(H,188,234)(H,189,254)(H,190,232)(H,191,250)(H,192,251)(H,193,252)(H,194,245)(H,195,255)(H,196,256)(H,197,257)(H,198,229)(H,199,253)(H,200,233)(H,201,239)(H,202,238)(H,203,240)(H,204,246)(H,205,249)(H,206,241)(H,223,224)(H,225,226)(H,227,228)(H,261,262)(H4,175,176,177);(H,6,7)/t81-,82-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,129-,130-;/m0./s1
InChi Key
KYBGUARAPORDIX-WMWDNWMISA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $109

    Add

    5 mg

    $517

    Add

    10 mg

    $818

    Add
    Product Description

    Wasabi receptor toxin (WaTx) (36-68) is a cell-penetrating peptide that corresponds to the mature toxin sequence and is an activator of transient receptor potential ankyrin 1 (TRPA1).1 It selectively induces currents in HEK293T cells expressing human TRPA1 (EC50 = 15 nM) over cells expressing human TRP melastatin 8 (TRPM8) or human TRP vanilloid 1 (TRPV1) at 100 nM or rat voltage-gated potassium channel 1.2 (Kv1.2), rat Kv2.1, rat Kv3.1, or rat Kv4.3 at 1,000 nM. WaTx induces nocifensive behavior in wild-type but not Trpa1-/- mice.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. King, J.V.L., Emrick, J.J., Kelly, M.J.S., et al. A cell-penetrating scorpion toxin enables mode-specific modulation of TRPA1 and pain. Cell 178(6), 1362-1374 (2019).