A peptide inhibitor of the ASIC1a-RIPK1 interaction
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Tat-ASIC1a (1-20) (mouse, rat) (trifluoroacetate salt)

Item No. 37501

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Synonyms
  • NT1-20
  • Tat-Acid-sensing Ion Channel 1a (1-20)
Molecular Formula
C150H265N55O47S2 • XCF3COOH
Formula Weight
3655.2
Purity
≥95%
Formulation (Request formulation change)
A solid
Peptide Sequence
GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA-OH
Solubility(Learn about Variance in Solubility)
Water: Soluble
SMILES
[H]NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@]([C@@H](C)O)([H])C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](C(C)C)C(NCC(NCC(N[C@@H](C(C)C)C(N[C@@H](CCC(N)=O)C(N1CCC[C@H]1C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CCC(N)=O)C(N[C@H](C(O)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CCSC)=O)CS)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C150H265N55O47S2.C2HF3O2/c1-14-76(10)115(141(248)194-88(38-46-101(155)208)117(224)178-77(11)144(251)252)203-135(242)98(70-206)198-140(247)114(75(8)9)202-137(244)100-37-27-64-205(100)143(250)96(40-48-103(157)210)196-139(246)113(74(6)7)200-106(213)69-176-105(212)68-177-138(245)112(73(4)5)201-133(240)94(45-53-111(222)223)192-128(235)91(42-50-108(216)217)189-127(234)90(41-49-107(214)215)190-129(236)93(44-52-110(220)221)195-142(249)116(78(12)207)204-132(239)82(30-17-20-57-153)187-134(241)97(66-72(2)3)197-130(237)92(43-51-109(218)219)191-131(238)95(54-65-254-13)193-136(243)99(71-253)199-125(232)87(36-26-63-175-150(168)169)185-122(229)84(33-23-60-172-147(162)163)183-123(230)85(34-24-61-173-148(164)165)186-126(233)89(39-47-102(156)209)188-124(231)86(35-25-62-174-149(166)167)184-121(228)83(32-22-59-171-146(160)161)182-120(227)81(29-16-19-56-152)181-119(226)80(28-15-18-55-151)180-118(225)79(179-104(211)67-154)31-21-58-170-145(158)159;3-2(4,5)1(6)7/h72-100,112-116,206-207,253H,14-71,151-154H2,1-13H3,(H2,155,208)(H2,156,209)(H2,157,210)(H,176,212)(H,177,245)(H,178,224)(H,179,211)(H,180,225)(H,181,226)(H,182,227)(H,183,230)(H,184,228)(H,185,229)(H,186,233)(H,187,241)(H,188,231)(H,189,234)(H,190,236)(H,191,238)(H,192,235)(H,193,243)(H,194,248)(H,195,249)(H,196,246)(H,197,237)(H,198,247)(H,199,232)(H,200,213)(H,201,240)(H,202,244)(H,203,242)(H,204,239)(H,214,215)(H,216,217)(H,218,219)(H,220,221)(H,222,223)(H,251,252)(H4,158,159,170)(H4,160,161,171)(H4,162,163,172)(H4,164,165,173)(H4,166,167,174)(H4,168,169,175);(H,6,7)/t76-,77-,78+,79-,80-,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,112-,113-,114-,115-,116-;/m0./s1
InChi Key
CQPADEWOXIXOJJ-MJQRXGMWSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $65

    Add

    5 mg

    $260

    Add

    10 mg

    $390

    Add
    Product Description

    Tat-ASIC1a (1-20) is a synthetic peptide composed of the cell-penetrating peptide sequence from the HIV-1 Tat protein transduction domain linked to a 20-amino acid peptide corresponding to amino acids 1-20 of acid-sensing ion channel 1a (ASIC1a).1 It prevents acid-induced association of ASIC1a with receptor-interacting serine/threonine kinase 1 (RIPK1) and necroptosis in primary mouse cortical neurons when used at a concentration of 10 µM. Tat-ASIC1a (1-20) decreases infarct volume in a mouse model of ischemia induced by middle cerebral artery occlusion (MCAO).

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Wang, J.-J., Liu, F., Yang, F., et al. Disruption of auto-inhibition underlies conformational signaling of ASIC1a to induce neuronal necroptosis. Nat. Commun. 11(1), 475 (2020).