An antimicrobial peptide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

CRAMP (140-173) (mouse) (trifluoroacetate salt)

Item No. 37502

Technical Information
Synonyms
  • Cathelicidin-related Antimicrobial Peptide
  • Cathelin-related Antimicrobial Peptide
  • mCRAMP
Molecular Formula
C178H302N50O46 • XCF3COOH
Formula Weight
Purity
≥95%
A solid
Peptide Sequence
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH
Methanol: SolubleWater: Soluble
SMILES
[H]NCC(N[C@@H](CC(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(NCC(NCC(N[C@@H](CCC(O)=O)C(N[C@@H](CCCCN)C(N[C@]([C@H](CC)C)([H])C(NCC(N[C@@H](CCC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@]([C@H](CC)C)([H])C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CCCCN)C(N[C@@H](CC(N)=O)C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N1CCC[C@H]1C(N[C@@H](CCC(N)=O)C(N2CCC[C@H]2C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(N)=O)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CC=CC=C3)=O)CC4=CC=CC=C4)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C178H302N50O46.C2HF3O2/c1-17-102(14)146(224-160(256)112(54-31-39-79-184)207-150(246)108(50-27-35-75-180)210-164(260)124(86-98(6)7)217-152(248)109(51-28-36-76-181)205-156(252)118(65-72-143(241)242)202-141(238)96-199-173(269)147(103(15)18-2)225-161(257)113(55-32-40-80-185)209-157(253)117(64-71-142(239)240)201-139(236)94-196-138(235)93-197-149(245)107(49-26-34-74-179)204-151(247)115(57-42-82-195-178(193)194)211-165(261)125(87-99(8)9)219-163(259)123(85-97(4)5)203-137(234)92-187)172(268)198-95-140(237)200-116(60-67-132(188)229)155(251)208-114(56-33-41-81-186)162(258)226-148(104(16)19-3)174(270)214-111(53-30-38-78-183)154(250)222-129(91-136(192)233)168(264)221-128(90-106-47-24-21-25-48-106)167(263)220-127(89-105-45-22-20-23-46-105)166(262)212-119(61-68-133(189)230)158(254)206-110(52-29-37-77-182)153(249)218-126(88-100(10)11)169(265)223-145(101(12)13)176(272)228-84-44-59-131(228)171(267)215-121(62-69-134(190)231)175(271)227-83-43-58-130(227)170(266)213-120(66-73-144(243)244)159(255)216-122(177(273)274)63-70-135(191)232;3-2(4,5)1(6)7/h20-25,45-48,97-104,107-131,145-148H,17-19,26-44,49-96,179-187H2,1-16H3,(H2,188,229)(H2,189,230)(H2,190,231)(H2,191,232)(H2,192,233)(H,196,235)(H,197,245)(H,198,268)(H,199,269)(H,200,237)(H,201,236)(H,202,238)(H,203,234)(H,204,247)(H,205,252)(H,206,254)(H,207,246)(H,208,251)(H,209,253)(H,210,260)(H,211,261)(H,212,262)(H,213,266)(H,214,270)(H,215,267)(H,216,255)(H,217,248)(H,218,249)(H,219,259)(H,220,263)(H,221,264)(H,222,250)(H,223,265)(H,224,256)(H,225,257)(H,226,258)(H,239,240)(H,241,242)(H,243,244)(H,273,274)(H4,193,194,195);(H,6,7)/t102-,103-,104-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,145-,146-,147-,148-;/m0./s1
InChi Key
YJTAWWUXDUOTPG-YDXIAEGNSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Cayman Chemical
    Neutrophil Biology Wall Poster

    Explore how neutrophils shape the immune response in health and disease. This poster highlights neutrophil pathogen defense mechanisms, including phagocytosis, degranulation, and NETosis, as well as neutrophil roles in inflammation and NET-associated pathologies.

    DOWNLOAD NOW
    Product Description

    Cathelicidin-related antimicrobial peptide (CRAMP) (140-173) is a 34-amino acid peptide derivative of the 38-amino acid antimicrobial peptide CRAMP.1,2 Mature CRAMP is formed from cleavage of the full-length peptide by cathepsin G.3,4 CRAMP (140-173) (1 µg/ml) is active against K. pneumoniae in vitro.1 It decreases neutrophil infiltration of colonic epithelial and luminal surfaces in a porcine model of colitis when administered at a dose of 10 mg/kg.5 Ileal administration of CRAMP (140-173) (10 mg/kg) decreases disease severity and cecal bacterial burden and increases survival in a mouse model of C. difficile infection.6 However, intra-articular administration of CRAMP (140-173) (10 µl of 25 µM) also increases disease severity and induces synovitis in a mouse model of surgery-induced osteoarthritis.7

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Kovach, M.A., Ballinger, M.N., Newstead, M.W., et al. Cathelicidin-related antimicrobial peptide is required for effective lung mucosal immunity in Gram-negative bacterial pneumonia. J. Immunol. 189(1), 304-311 (2012).

    2. Shin, S.Y., Kang, S.W., Lee, D.G., et al. CRAMP analogues having potent antibiotic activity against bacterial, fungal, and tumor cells without hemolytic activity. Biochem. Biophys. Res. Commun. 275(3), 904-909 (2000).

    3. Gallo, R.L., Kim, K.J., Bernfield, M., et al. Identification of CRAMP, a cathelin-related antimicrobial peptide expressed in the embryonic and adult mouse. The Journal of Biological Chemisty 272(20), 13088-13093 (1997).

    4. Woloszynek, J.C., Hu, Y., and Pham, C.T.N. Cathepsin G-regulated release of formyl peptide receptor agonists modulate neutrophil effector functions. The Journal of Biological Chemisty 287(41), 34101-34109 (2012).

    5. Fodor, C.C., McCorkell, R., Muench, G., et al. Systemic murine cathelicidin CRAMP safely attenuated colonic neutrophil infiltration in pigs. Vet. Immunol. Immunopathol. 249, 110443 (2022).

    6. Xu, B., Wu, X., Gong, Y., et al. IL-27 induces LL-37/CRAMP expression from intestinal epithelial cells: Implications for immunotherapy of Clostridioides difficile infection. Gut Microbes 13(1), 1968258 (2021).

    7. Choi, M.-C., Jo, J., Lee, M., et al. Intra-articular administration of cramp into mouse knee joint exacerbates experimental osteoarthritis progression. Int. J. Mol. Sci. 22(7), 3249 (2021).