A melittin derivative
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Melittin (C-Term Cysteine labeled) (trifluoroacetate salt)

Item No. 37504

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
glycyl-L-isoleucylglycyl-L-alanyl-L-valyl-L-leucyl-L-lysyl-L-valyl-L-leucyl-L-threonyl-L-threonylglycyl-L-leucyl-L-prolyl-L-alanyl-L-leucyl-L-isoleucyl-L-seryl-L-tryptophyl-L-isoleucyl-L-lysyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-cysteinamide, trifluoroacetate salt
Synonyms
  • Mel-Cys
Molecular Formula
C134H234N40O32S • XCF3COOH
Formula Weight
2949.6
Purity
≥95%
Formulation (Request formulation change)
A solid
Peptide Sequence
GIGAVLKVLTTGLPALISWIKRKRQQC-NH2
Solubility(Learn about Variance in Solubility)
30% ACN/H2O: Soluble
λmax
280 nm
SMILES
[H]NCC(N[C@]([C@H](CC)C)([H])C(NCC(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@@H](C(C)C)C(N[C@@H](CC(C)C)C(N[C@]([C@@H](C)O)([H])C(N[C@]([C@@H](C)O)([H])C(NCC(N[C@@H](CC(C)C)C(N1CCC[C@H]1C(N[C@H](C(N[C@@H](CC(C)C)C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CO)C(N[C@H](C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@H](C(N)=O)CS)=O)=O)=O)=O)=O)=O)=O)=O)CC2=CNC3=C2C=CC=C3)=O)=O)=O)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)C)=O)=O)=O.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C134H234N40O32S.C2HF3O2/c1-23-72(16)104(167-99(180)60-138)125(199)149-62-100(181)151-75(19)111(185)168-102(70(12)13)127(201)163-89(55-66(4)5)119(193)157-84(41-30-33-51-137)118(192)169-103(71(14)15)128(202)164-91(57-68(8)9)121(195)172-108(78(22)177)131(205)173-107(77(21)176)126(200)150-63-101(182)153-93(58-69(10)11)132(206)174-54-36-44-96(174)124(198)152-76(20)110(184)161-90(56-67(6)7)120(194)170-106(74(18)25-3)130(204)165-94(64-175)123(197)162-92(59-79-61-148-81-38-27-26-37-80(79)81)122(196)171-105(73(17)24-2)129(203)160-83(40-29-32-50-136)113(187)156-85(42-34-52-146-133(142)143)114(188)154-82(39-28-31-49-135)112(186)155-86(43-35-53-147-134(144)145)115(189)158-87(45-47-97(139)178)116(190)159-88(46-48-98(140)179)117(191)166-95(65-207)109(141)183;3-2(4,5)1(6)7/h26-27,37-38,61,66-78,82-96,102-108,148,175-177,207H,23-25,28-36,39-60,62-65,135-138H2,1-22H3,(H2,139,178)(H2,140,179)(H2,141,183)(H,149,199)(H,150,200)(H,151,181)(H,152,198)(H,153,182)(H,154,188)(H,155,186)(H,156,187)(H,157,193)(H,158,189)(H,159,190)(H,160,203)(H,161,184)(H,162,197)(H,163,201)(H,164,202)(H,165,204)(H,166,191)(H,167,180)(H,168,185)(H,169,192)(H,170,194)(H,171,196)(H,172,195)(H,173,205)(H4,142,143,146)(H4,144,145,147);(H,6,7)/t72-,73-,74-,75-,76-,77+,78+,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,102-,103-,104-,105-,106-,107-,108-;/m0./s1
InChi Key
DJXAVHHNEHIXKN-FXQKTPAXSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $146

    Add
    Product Description

    Melittin (C-term cysteine labeled) is a derivative of the cytotoxic bee venom peptide melittin (Item No. 17494) with a cysteine residue at the C-terminus.1,2 It induces hemolysis of isolated human red blood cells at endosomal and extracellular pHs (EC50s = 5 and 6 µM at pH 5.5 and 7.4, respectively).1 Melittin (C-term cysteine labeled) has been used in the synthesis of membrane-lytic polymers that have been used in the generation of polyplexes for plasmid delivery in vitro and in vivo.2

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Peeler, D.J., Thai, S.N., Cheng, Y., et al. pH-Sensitive polymer micelles provide selective and potentiated lytic capacity to venom peptides for effective intracellular delivery. Biomaterials 192, 235-244 (2019).

    2. Schellinger, J.G., Pahang, J.A., Johnson, R.N., et al. Melittin-grafted HPMA-oligolysine based copolymers for gene delivery. Biomaterials 34(9), 2318-2326 (2013).