A natriuretic peptide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Brain Natriuretic Peptide-32 (rat) (acetate)

Item No. 39724

Technical Information
Synonyms
  • B-type Natriuretic Peptide-32
  • BNP-32
  • BNP (14-45)
  • Brain Natriuretic Polypeptide-32
Molecular Formula
C146H239N47O44S3 • XC2H4O2
Formula Weight
Purity
≥98%
A solid
Peptide Sequence
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF-OH
Water: Soluble
SMILES
O=C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N[C@@H](CCSC)C(N[C@H](C(N[C@@H](CC1=CNC=N1)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CSSC[C@H](N2)C(N[C@@H](CC(O)=O)C(NCC(N[C@H](C(N[C@@H](CCC/N=C(N)/N)C(N[C@H](C(N[C@H](C(O)=O)CC3=CC=CC=C3)=O)CC(C)C)=O)=O)CC(C)C)=O)=O)=O)C(N[C@H](C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@](C(N[C@@H](CC(O)=O)C(N[C@@H](CCC/N=C(N)/N)C(N[C@@](C(NCC(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CCC/N=C(N)/N)C(N[C@H](C(NCC2=O)=O)CC(C)C)=O)=O)=O)=O)C)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)CC4=CC=CC=C4)=O)=O)=O)=O)=O)=O)C)=O)=O)=O)[C@H](CC(N)=O)N[H].CC(O)=O
InChi Code
InChI=1S/C146H239N47O44S3.C2H4O2/c1-16-75(11)114-140(233)165-59-107(201)167-77(13)117(210)191-113(74(9)10)141(234)189-102(67-198)134(227)176-86(38-29-46-160-145(154)155)124(217)179-90(49-71(3)4)119(212)162-62-110(204)171-103(138(231)182-95(56-111(205)206)121(214)164-61-109(203)170-91(50-72(5)6)129(222)173-85(37-28-45-159-144(152)153)125(218)180-92(51-73(7)8)130(223)184-97(143(236)237)53-80-33-22-19-23-34-80)68-239-240-69-104(139(232)181-93(52-79-31-20-18-21-32-79)120(213)163-60-108(202)169-88(40-41-105(150)199)126(219)172-84(36-25-27-44-148)127(220)193-115(76(12)17-2)142(235)183-96(57-112(207)208)132(225)174-87(128(221)192-114)39-30-47-161-146(156)157)190-137(230)101(66-197)188-136(229)100(65-196)187-135(228)99(64-195)186-131(224)94(54-81-58-158-70-166-81)178-116(209)78(14)168-122(215)89(42-48-238-15)177-123(216)83(35-24-26-43-147)175-133(226)98(63-194)185-118(211)82(149)55-106(151)200;1-2(3)4/h18-23,31-34,58,70-78,82-104,113-115,194-198H,16-17,24-30,35-57,59-69,147-149H2,1-15H3,(H2,150,199)(H2,151,200)(H,158,166)(H,162,212)(H,163,213)(H,164,214)(H,165,233)(H,167,201)(H,168,215)(H,169,202)(H,170,203)(H,171,204)(H,172,219)(H,173,222)(H,174,225)(H,175,226)(H,176,227)(H,177,216)(H,178,209)(H,179,217)(H,180,218)(H,181,232)(H,182,231)(H,183,235)(H,184,223)(H,185,211)(H,186,224)(H,187,228)(H,188,229)(H,189,234)(H,190,230)(H,191,210)(H,192,221)(H,193,220)(H,205,206)(H,207,208)(H,236,237)(H4,152,153,159)(H4,154,155,160)(H4,156,157,161);1H3,(H,3,4)/t75-,76-,77-,78-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,113-,114-,115-;/m0./s1
InChi Key
WMDBJLZJMHKFIB-HXFOMJTMSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Product Description

    Brain natriuretic peptide-32 (BNP-32) is a peptide fragment of the cardiovascular hormone precursor proBNP.1 It binds to natriuretic peptide receptors on rat vascular smooth muscle cells (IC50 = 7.3 nM) and induces cGMP accumulation in the same cells (EC50 = 170 nM). BNP-32 induces relaxation of norepinephrine-precontracted isolated rat aortic strips (EC50 = 6.7 nM). It increases urine and urinary electrolyte excretion and induces hypotension in rats when administered at a dose of 3 µg/kg.

    WARNING This product is not for human or veterinary use.