A Wnt/β-catenin signaling inhibitor
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Klotho-derived Peptide 6 (acetate)

Item No. 41263

Technical Information
Formal Name
L-glutaminyl-L-prolyl-L-valyl-L-valyl-L-threonyl-L-leucyl-L-tyrosyl-L-histidyl-L-tryptophyl-L-α-aspartyl-L-leucyl-L-prolyl-L-glutaminyl-L-arginyl-L-leucyl-L-glutaminyl-L-α-aspartyl-L-alanyl-L-tyrosylglycylglycyl-L-tryptophyl-L-alanyl-L-asparaginyl-L-arginyl-L-alanyl-L-leucyl-L-alanyl-L-α-aspartyl-L-histidine, acetate
Synonyms
  • Klotho (186-215) (human)
  • KP6
Molecular Formula
C159H232N46O44 • XC2H4O2
Formula Weight
Purity
≥90%
A solid
Peptide Sequence
QPVVTLYHWDLPQRLQDAYGGWANRALADH-OH
SMILES
O=C(N1CCC[C@H]1C(N[C@@H](C(C)C)C(N[C@@H](C(C)C)C(N[C@]([C@H](O[H])C)([H])C(N[C@H](C(N[C@@H](CC2=CC=C(O[H])C=C2)C(N[C@@H](CC3=CN([H])C=N3)C(N[C@@H](CC4=CN([H])C5=C4C=CC=C5)C(N[C@@H](CC(O)=O)C(N[C@H](C(N6CCC[C@H]6C(N[C@@H](CCC(N[H])=O)C(N[C@@H](CCC/N=C(N[H])/N)C(N[C@H](C(N[C@@H](CCC(N[H])=O)C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@@H](CC7=CC=C(O[H])C=C7)C(NCC(NCC(N[C@@H](CC8=CN([H])C9=C8C=CC=C9)C(N[C@H](C(N[C@@H](CC(N[H])=O)C(N[C@@H](CCC/N=C(N[H])/N)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](CC%10=CN([H])C=N%10)C(O)=O)=O)=O)C)=O)CC(C)C)=O)C)=O)=O)=O)C)=O)=O)=O)=O)=O)C)=O)=O)=O)CC(C)C)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)[C@H](CCC(N[H])=O)N[H].CC(O)=O
InChi Code
InChI=1S/C159H232N46O44.C2H4O2/c1-74(2)52-102(139(230)180-83(16)133(224)191-112(64-125(217)218)149(240)200-115(157(248)249)61-90-69-170-73-178-90)188-130(221)80(13)179-135(226)98(30-22-48-171-158(165)166)185-147(238)110(62-121(164)212)190-132(223)82(15)181-140(231)107(58-87-66-173-96-28-20-18-26-93(87)96)183-123(214)71-175-122(213)70-176-134(225)105(56-85-34-38-91(207)39-35-85)189-131(222)81(14)182-141(232)111(63-124(215)216)196-138(229)100(43-46-119(162)210)186-142(233)103(53-75(3)4)192-136(227)99(31-23-49-172-159(167)168)184-137(228)101(44-47-120(163)211)187-150(241)116-32-25-51-205(116)156(247)114(55-77(7)8)199-148(239)113(65-126(219)220)197-145(236)108(59-88-67-174-97-29-21-19-27-94(88)97)194-146(237)109(60-89-68-169-72-177-89)195-144(235)106(57-86-36-40-92(208)41-37-86)193-143(234)104(54-76(5)6)198-154(245)129(84(17)206)203-153(244)128(79(11)12)202-152(243)127(78(9)10)201-151(242)117-33-24-50-204(117)155(246)95(160)42-45-118(161)209;1-2(3)4/h18-21,26-29,34-41,66-69,72-84,95,98-117,127-129,173-174,206-208H,22-25,30-33,42-65,70-71,160H2,1-17H3,(H2,161,209)(H2,162,210)(H2,163,211)(H2,164,212)(H,169,177)(H,170,178)(H,175,213)(H,176,225)(H,179,226)(H,180,230)(H,181,231)(H,182,232)(H,183,214)(H,184,228)(H,185,238)(H,186,233)(H,187,241)(H,188,221)(H,189,222)(H,190,223)(H,191,224)(H,192,227)(H,193,234)(H,194,237)(H,195,235)(H,196,229)(H,197,236)(H,198,245)(H,199,239)(H,200,240)(H,201,242)(H,202,243)(H,203,244)(H,215,216)(H,217,218)(H,219,220)(H,248,249)(H4,165,166,171)(H4,167,168,172);1H3,(H,3,4)/t80-,81-,82-,83-,84+,95-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,127-,128-,129-;/m0./s1
InChi Key
NRCFASGNOBTLBI-FDNSJZPQSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Wet ice in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Product Description

    Klotho-derived peptide 6 (KP6) is a synthetic peptide fragment that corresponds to amino acids 186-215 of the anti-aging protein Klotho.1 It inhibits Wnt1-induced increases in fibronectin and α-smooth muscle actin (α-SMA) levels in HKC-8 human proximal tubular cells. KP6 (5 µg/ml) also inhibits Wnt3a-induced activation of β-catenin in a reporter assay using HEK293T cells. In vivo, KP6 (1 mg/kg) increases survival and decreases urine albumin levels, renal hypertrophy, and glomerular injury in a mouse model of diabetic kidney disease induced by streptozotocin (STZ; Item No. 13104), advanced oxidation protein products, and unilateral nephrectomy.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Chen, X., Tan, H., Xu, J., et al. Klotho-derived peptide 6 ameliorates diabetic kidney disease by targeting Wnt/β-catenin signaling. Kidney Int. 102(3), 506-520 (2022).