An endogenous peptide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Melanostatin (frog, eel) (trifluoroacetate salt)

Item No. 41461

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
19-L-lysine-neuropeptide Y (human), trifluoroacetate salt
Synonyms
  • Neuropeptide Y
  • NPY
Molecular Formula
C189H285N53O57S • XCF3COOH
Formula Weight
4243.7
Purity
≥95%
Formulation (Request formulation change)
A solid
Peptide Sequence
YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY-NH2
Solubility(Learn about Variance in Solubility)
DMSO: Sparingly soluble: 1-10 mg/ml
SMILES
[H]N[C@H](C(N1CCC[C@H]1C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N2CCC[C@H]2C(N[C@H](C(N[C@@H](CC(N)=O)C(N3CCC[C@H]3C(NCC(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@H](C(N4CCC[C@H]4C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCCCN)C(N[C@H](C(N[C@H](C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@H](C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CC(N)=O)C(N[C@@H](CC(C)C)C(N[C@]([C@H](CC)C)([H])C(N[C@]([C@@H](C)O)([H])C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N)=O)CC5=CC=C(O)C=C5)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC6=CC=C(O)C=C6)=O)CC7=CN=CN7)=O)=O)=O)C)=O)=O)CC8=CC=C(O)C=C8)=O)CC9=CC=C(O)C=C9)=O)=O)C)=O)CCSC)=O)CC(O)=O)=O)=O)C)=O)=O)C)=O)CC(O)=O)=O)=O)=O)=O)=O)CC(O)=O)=O)=O)=O)=O)=O)CC%10=CC=C(O)C=C%10.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C189H285N53O57S.C2HF3O2/c1-15-94(7)149(180(293)232-129(82-141(194)252)169(282)224-124(75-93(5)6)172(285)237-150(95(8)16-2)181(294)238-151(100(13)245)182(295)220-116(32-23-68-206-189(201)202)157(270)218-118(57-60-140(193)251)162(275)216-114(30-21-66-204-187(197)198)158(271)222-122(152(196)265)77-102-39-49-108(247)50-40-102)236-173(286)127(80-105-45-55-111(250)56-46-105)227-168(281)128(81-106-87-203-91-208-106)228-160(273)115(31-22-67-205-188(199)200)217-165(278)123(74-92(3)4)223-155(268)97(10)210-174(287)134(89-243)234-167(280)126(79-104-43-53-110(249)54-44-104)226-166(279)125(78-103-41-51-109(248)52-42-103)225-159(272)113(28-17-19-64-190)214-153(266)96(9)209-156(269)120(63-73-300-14)219-170(283)131(85-147(261)262)230-163(276)119(59-62-145(257)258)215-154(267)98(11)211-177(290)137-34-25-69-239(137)183(296)99(12)212-164(277)130(84-146(259)260)229-161(274)117(58-61-144(255)256)213-143(254)88-207-176(289)136-33-24-71-241(136)186(299)133(83-142(195)253)233-171(284)132(86-148(263)264)231-178(291)139-36-27-72-242(139)185(298)121(29-18-20-65-191)221-175(288)135(90-244)235-179(292)138-35-26-70-240(138)184(297)112(192)76-101-37-47-107(246)48-38-101;3-2(4,5)1(6)7/h37-56,87,91-100,112-139,149-151,243-250H,15-36,57-86,88-90,190-192H2,1-14H3,(H2,193,251)(H2,194,252)(H2,195,253)(H2,196,265)(H,203,208)(H,207,289)(H,209,269)(H,210,287)(H,211,290)(H,212,277)(H,213,254)(H,214,266)(H,215,267)(H,216,275)(H,217,278)(H,218,270)(H,219,283)(H,220,295)(H,221,288)(H,222,271)(H,223,268)(H,224,282)(H,225,272)(H,226,279)(H,227,281)(H,228,273)(H,229,274)(H,230,276)(H,231,291)(H,232,293)(H,233,284)(H,234,280)(H,235,292)(H,236,286)(H,237,285)(H,238,294)(H,255,256)(H,257,258)(H,259,260)(H,261,262)(H,263,264)(H4,197,198,204)(H4,199,200,205)(H4,201,202,206);(H,6,7)/t94-,95-,96-,97-,98-,99-,100+,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,149-,150-,151-;/m0./s1
InChi Key
FOGWIKBSACANEP-ZWYMSMRWSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $43

    Add

    5 mg

    $194

    Add

    10 mg

    $280

    Add

    25 mg

    $590

    Add
    Product Description

    Melanostatin is an endogenous peptide.1,2 It is formed from pro-neuropeptide Y when pro-neuropeptide Y is cleaved into melanostatin and C-flanking peptide of neuropeptide Y (NPY).2 Melanostatin inhibits α-melanocyte-stimulating hormone (α-MSH) release from primary frog neurointermediate lobes (NILs; ED50 = 100 nM).1 It inhibits thyrotropin-releasing hormone-induced increases in intracellular calcium in primary frog melanotrope cells when used at a concentration of 100 nM. Intracerebroventricular administration of melanostatin (5 or 10 nmol/kg) increases food intake in frog larvae.3 It increases mean blood pressure in normotensive sharks when administered at a dose of 5 nmol/kg.4

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Galas, L., Tonon, M.C., Beaujean, D., et al. Neuropeptide Y inhibits spontaneous α-melanocyte-stimulating hormone (α-MSH) release via a Y5 receptor and suppresses thyrotropin-releasing hormone-induced α-MSH secretion via a Y1 receptor in frog melanotrope cells. Endocrinology 143(5), 1686-1694 (2002).

    2. Holzer, P., Reichmann, F., and Farzi, A. Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis. Neuropeptides 46(6), 261-274 (2012).

    3. Shimizu, S., Azuma, M., Morimoto, N., et al. Effect of neuropeptide Y on food intake in bullfrog larvae. Peptides 46, 102-107 (2013).

    4. Preston, E., Jönsson, A.-C., McManus, C.D., et al. Comparative vascular responses in elasmobranchs to different structures of neuropeptide Y and peptide YY. Regul. Pept. 78(1-3), 57-67 (1998).