Host: E. coli • AA: 67-451 • Tag: N-terminal His • MW: 42.4 kDa
Technical Support & Resources

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

FPPS Short Isoform (human, recombinant)

Item No. 43695

Technical Information
Synonyms
  • Dimethylallyltranstransferase
  • Farnesyl Diphosphate Synthase
  • (2E,6E)-Farnesyl Diphosphate Synthase
  • Farnesyl Pyrophosphate Synthase
  • FPP Synthase
Purity
≥85% as estimated by SDS-PAGE
Source
Recombinant human N-terminal His-tagged FPPS short isoform expressed in E. coli
Amino Acids
67-435
MW
42.4 kDa
Lyophilized from sterile PBS, pH 7.5
Peptide Sequence
MHHHHHHLEVLFQGPMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKP GVGLDAINDAN
UniProt Accession №
P14324
Shipping & Storage Information
Storage
-80°C
Shipping
Dry ice in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Lipid Resource Center
    Discover Products & Resources for Lipid Research
    • High-purity lipid standards
    • Lipid roles in biology
    • Lipids in health & disease
    • Lipids for pharmaceutical development
    • Protocols, advice, & resources
    EXPLORE NOW
    Product Description

    Farnesyl diphosphate synthase (FPPS) is a prenyltransferase and a member of the farnesyl pyrophosphate/geranylgeranyl pyrophosphate (FPP/GPP) synthase family.1 It is composed of a single helical domain with a large central pocket that contains the active site.2 FPPS functions as a homodimer and catalyzes the sequential condensation of dimethylallyl pyrophosphate (DMAPP) to C15 farnesyl pyrophosphate, which is necessary for the biosynthesis of isoprenoids, sterols, and prenylated proteins.1,3 A shorter isoform of FPPS lacks the N-terminal mitochondrial targeting peptide and localizes to the cytoplasm and, to a lesser extent, in lysosomes.1 Increased levels of mRNA encoding FPPS in the frontal cortex are associated with higher levels of phosphorylated tau and earlier disease onset in patients with Alzheimer's disease.4 Cayman's FPPS Short Isoform (human, recombinant) protein consists of 368 amino acids and has a calculated molecular weight of 42.4 kDa.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Dhar, M.K., Koul, A., and Kaul, S. Farnesyl pyrophosphate synthase: A key enzyme in isoprenoid biosynthetic pathway and potential molecular target for drug development. N. Biotechnol. 30(2), 114-123 (2013).

    2. Kavanagh, K.L., Guo, K., Dunford, J.E., et alThe molecular mechanism of nitrogen-containing bisphosphonates as antiosteoporosis drugs. Proc. Natl. Acad. Sci. U S A 103(20), 7829-7834 (2006).

    3. Dunford, J.E., Kwaasi, A.A., Rogers, M.J., et alStructure-activity relationships among the nitrogen containing bisphosphonates in clinical use and other analogues: Time-dependent inhibition of human farnesyl pyrophosphate synthase. J. Med. Chem. 51(7), 2187-2195 (2008).

    4. Pelleieux, S., Picard, C., Lamarre-Théroux, L., et alIsoprenoids and tau pathology in sporadic Alzheimer’s disease. Neurobiol. Aging 65, (2018).