A tumor-targeting peptide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

pH-Low Insertion Peptide (trifluoroacetate salt)

Item No. 46015

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Synonyms
  • pHLIP
Molecular Formula
C189H282N42O55S • XCF3COOH
Formula Weight
4054.6
Purity
≥95%
Formulation (Request formulation change)
A solid
Peptide Sequence
ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET-OH
Solubility(Learn about Variance in Solubility)
Acetonitrile:Water (1:1): Sparingly soluble: 1-10 mg/mlDMSO: Sparingly Soluble: 1-10 mg/ml
SMILES
C[C@@H](C(N[C@@H](CS[H])C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(N[H])=O)C(N[C@@H](CC(N[H])=O)C(N1CCC[C@H]1C(N[C@@](C(N[C@@H](CC2=CC=C(O[H])C=C2)C(N[C@@H](CC3=CN([H])C4=C3C=CC=C4)C(N[C@H](C(N[C@@H](CCC/N=C(N[H])/N)C(N[C@@H](CC5=CC=C(O[H])C=C5)C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](CC6=CN([H])C7=C6C=CC=C7)C(N[C@H](C(N[C@H](C(N[C@]([C@H](O[H])C)([H])C(N[C@]([C@H](O[H])C)([H])C(N8CCC[C@H]8C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@]([C@H](O[H])C)([H])C(O)=O)=O)=O)=O)C)=O)=O)=O)CC(C)C)=O)CC(C)C)=O)C)=O)CC(C)C)=O)=O)CC(C)C)=O)CC(C)C)=O)CC(C)C)=O)CC(C)C)=O)=O)=O)=O)CC9=CC=CC=C9)=O)CC(C)C)=O)=O)=O)C)=O)=O)=O)C)=O)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)=O)=O)N[H]
InChi Code
InChI=1S/C189H282N42O55S/c1-29-96(20)150(226-182(279)140-48-38-64-230(140)186(283)137(79-142(192)238)223-161(258)117(57-60-141(191)237)203-160(257)118(58-61-143(239)240)205-180(277)138(86-287)224-154(251)97(21)190)184(281)221-129(76-107-51-55-111(236)56-52-107)173(270)217-131(77-108-84-196-114-44-35-33-42-112(108)114)165(262)200-98(22)155(252)202-116(46-37-63-195-189(193)194)159(256)215-128(75-106-49-53-110(235)54-50-106)164(261)199-100(24)157(254)208-135(82-147(247)248)176(273)218-132(78-109-85-197-115-45-36-34-43-113(109)115)174(271)213-124(70-91(10)11)170(267)216-130(74-105-40-31-30-32-41-105)179(276)227-151(102(26)232)185(282)228-152(103(27)233)187(284)231-65-39-47-139(231)181(278)220-126(72-93(14)15)172(269)212-123(69-90(8)9)169(266)210-122(68-89(6)7)168(265)211-125(71-92(12)13)171(268)219-136(83-148(249)250)177(274)209-120(66-87(2)3)163(260)198-99(23)156(253)206-121(67-88(4)5)167(264)214-127(73-94(16)17)178(275)225-149(95(18)19)183(280)222-133(80-145(243)244)166(263)201-101(25)158(255)207-134(81-146(245)246)175(272)204-119(59-62-144(241)242)162(259)229-153(104(28)234)188(285)286/h30-36,40-45,49-56,84-85,87-104,116-140,149-153,196-197,232-236,287H,29,37-39,46-48,57-83,86,190H2,1-28H3,(H2,191,237)(H2,192,238)(H,198,260)(H,199,261)(H,200,262)(H,201,263)(H,202,252)(H,203,257)(H,204,272)(H,205,277)(H,206,253)(H,207,255)(H,208,254)(H,209,274)(H,210,266)(H,211,265)(H,212,269)(H,213,271)(H,214,264)(H,215,256)(H,216,267)(H,217,270)(H,218,273)(H,219,268)(H,220,278)(H,221,281)(H,222,280)(H,223,258)(H,224,251)(H,225,275)(H,226,279)(H,227,276)(H,228,282)(H,229,259)(H,239,240)(H,241,242)(H,243,244)(H,245,246)(H,247,248)(H,249,250)(H,285,286)(H4,193,194,195)/t96-,97-,98-,99-,100-,101-,102+,103+,104+,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,149-,150-,151-,152-,153-/m0/s1
InChi Key
GHOAMUSBZVQHHQ-VFOHMRHHSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $125

    Add

    5 mg

    $313

    Add

    10 mg

    $500

    Add
    Cayman Chemical
    Visit Our Cancer Resource Center
    Find Tools & Resources to Study the Hallmarks of Cancer
    • Cancer cell signaling & regulation
    • Cancer metabolism
    • Tumor microenvironment
    EXPLORE NOW
    Product Description

    pH-Low insertion peptide (pHLIP) is a tumor-targeting peptide.1,2 It associates with and inserts across the cellular membrane to form a transmembrane α-helix in low pH conditions, such as the acidic microenvironment of solid tumors. pHLIP accumulates in tumor tissue in a transgenic adenocarcinoma of mouse prostate (TRAMP) model and a HeLa cervical cancer mouse xenograft model.1 It is selective for M4A4 highly metastatic breast cancer tumor tissue over NM3C5 weakly metastatic breast cancer tumor tissue in M4A4 and NM3C5 mouse xenograft models1 pHLIP-containing conjugates have been used in the detection and imaging of tumors in mice.1,2

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1.  .

    2.  .