Mature peptide and APJ agonist
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Apelin-36 (trifluoroacetate salt)

Item No. 13524

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginylglycyl-L-seryl-L-arginyl-L-asparaginylglycyl-L-prolylglycyl-L-prolyl-L-tryptophyl-L-glutaminylglycylglycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysylglycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine, trifluoroacetate salt
Molecular Formula
C184H297N69O43S • XCF3COOH
Formula Weight
4195.8
Purity
≥95%
Amino Acids
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Formulation (Request formulation change)
A crystalline solid
Peptide Sequence
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Solubility(Learn about Variance in Solubility)
DMF: 30 mg/mlDMSO: 30 mg/mlEthanol: 10 mg/mlPBS (pH 7.2): 10 mg/ml
SMILES
[H]N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCC(N)=O)C(N1CCC[C@H]1C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(N)=O)C(NCC(N2CCC[C@H]2C(NCC(N3CCC[C@H]3C(N[C@H](C(N[C@@H](CCC(N)=O)C(NCC(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N4CCC[C@H]4C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CCCCN)C(NCC(N5CCC[C@H]5C(N[C@H](C(N6CCC[C@H]6C(N[C@H](C(O)=O)CC7=CC=CC=C7)=O)=O)CCSC)=O)=O)=O)=O)CC8=CN=CN8)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC9=CC=CC=C9)=O)=O)=O)=O)=O)=O)=O)CC%10=CNC%11=C%10C=CC=C%11)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C184H297N69O43S.C2HF3O2/c1-98(2)80-106(187)147(266)247-146(100(5)6)172(291)239-120(58-61-138(190)258)174(293)252-77-32-53-133(252)169(288)235-109(42-20-65-209-177(192)193)148(267)220-91-142(262)226-128(95-254)164(283)232-115(47-25-70-214-182(202)203)157(276)243-126(86-139(191)259)151(270)222-93-143(263)248-73-28-50-130(248)166(285)223-94-145(265)250-75-30-52-132(250)168(287)244-124(84-103-87-217-107-39-15-14-38-105(103)107)162(281)233-117(56-59-136(188)256)150(269)219-89-140(260)218-90-141(261)225-110(43-21-66-210-178(194)195)152(271)229-112(44-22-67-211-179(196)197)153(272)228-111(41-17-19-64-186)156(275)241-123(82-101-34-10-8-11-35-101)161(280)231-114(46-24-69-213-181(200)201)154(273)230-113(45-23-68-212-180(198)199)155(274)234-118(57-60-137(189)257)159(278)237-119(49-27-72-216-184(206)207)173(292)251-76-31-54-134(251)170(289)236-116(48-26-71-215-183(204)205)158(277)240-122(81-99(3)4)160(279)246-129(96-255)165(284)242-125(85-104-88-208-97-224-104)163(282)227-108(40-16-18-63-185)149(268)221-92-144(264)249-74-29-51-131(249)167(286)238-121(62-79-297-7)175(294)253-78-33-55-135(253)171(290)245-127(176(295)296)83-102-36-12-9-13-37-102;3-2(4,5)1(6)7/h8-15,34-39,87-88,97-100,106,108-135,146,217,254-255H,16-33,40-86,89-96,185-187H2,1-7H3,(H2,188,256)(H2,189,257)(H2,190,258)(H2,191,259)(H,208,224)(H,218,260)(H,219,269)(H,220,267)(H,221,268)(H,222,270)(H,223,285)(H,225,261)(H,226,262)(H,227,282)(H,228,272)(H,229,271)(H,230,273)(H,231,280)(H,232,283)(H,233,281)(H,234,274)(H,235,288)(H,236,289)(H,237,278)(H,238,286)(H,239,291)(H,240,277)(H,241,275)(H,242,284)(H,243,276)(H,244,287)(H,245,290)(H,246,279)(H,247,266)(H,295,296)(H4,192,193,209)(H4,194,195,210)(H4,196,197,211)(H4,198,199,212)(H4,200,201,213)(H4,202,203,214)(H4,204,205,215)(H4,206,207,216);(H,6,7)/t106-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,146-;/m0./s1
InChi Key
GTDTUUTXIDWMQY-NAMWIFIASA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    500 µg

    $219

    Add

    1 mg

    $416

    Add

    5 mg

    $1,095

    Add
    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Apelin-36 is the full-length mature peptide produced from the translated 77 amino acid prepropeptide. The apelins act primarily in the peripheral and central nervous system, playing important roles in regulating cardiovascular function, fluid homeostasis, hypertension, and insulin sensitivity.1 Apelin-36 is a less potent agonist of APJ than either apelin-17 or apelin-13 (EC50 = 20, 2.5, and 0.37 nM, respectively).2,3 Apelin-36 potently inhibits HIV-1 entry into cells expressing APJ and CD4, limiting HIV infection.4

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Kleinz, M.J., and Davenport, A.P. Emerging roles or apelin in biology and medicine. Pharmacol. Ther. 107(2), 198-211 (2005).

    2. Tatemoto, K., Hosoya, M., Habata, Y., et al. Isolation and characterizaton of a novel endogenous peptide ligand for the human APJ receptor. Biochem. Biophys. Res. Commun. 251(2), 471-476 (1998).

    3. Lee, D.K., Cheng, R., Nguyen, T., et al. Characterization of apelin, the ligand for the APJ receptor. J. Neurochem. 74(1), 34-41 (2000).

    4. Zou, M.X., Liu, H.Y., Haraguchi, Y., et al. Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473(1), 15-18 (2000).