A VPAC2 agonist
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

BAY 55-9837 (trifluoroacetate salt)

Item No. 36752

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-histidyl-L-seryl-L-α-aspartyl-L-alanyl-L-valyl-L-phenylalanyl-L-threonyl-L-α-aspartyl-L-asparaginyl-L-tyrosyl-L-threonyl-L-arginyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-valyl-L-alanyl-L-alanyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-isoleucyl-L-lysyl-L-asparaginyl-L-lysyl-L-arginyl-L-tyrosinamide, trifluoroacetate salt
Molecular Formula
C167H270N52O46 • XCF3COOH
Formula Weight
3742.3
Purity
≥98%
Formulation (Request formulation change)
A solid
Peptide Sequence
HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2
Solubility(Learn about Variance in Solubility)
DMF: 20 mg/mlDMSO: 30 mg/mlEthanol: 10 mg/mlPBS (pH 7.2): 5 mg/ml
SMILES
OC(C[C@H](NC([C@H](CO)NC([C@H](CC1=CNC=N1)N[H])=O)=O)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@H](C(N[C@@]([H])([C@@H](C)O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(C=C2)=CC=C2O)C(N[C@@]([H])([C@@H](C)O)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN[H])C(N[C@@H](CCC(N)=O)C(N[C@@H](C(C)C)C(N[C@H](C(N[C@H](C(N[C@@H](CCCCN[H])C(N[C@@H](CCCCN[H])C(N[C@@H](CC(C=C3)=CC=C3O)C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CO)C(N[C@@](C(N[C@@H](CCCCN[H])C(N[C@@H](CC(N)=O)C(N[C@@H](CCCCN[H])C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C=C4)=CC=C4O)C(N)=O)=O)=O)=O)=O)=O)([H])[C@H](CC)C)=O)=O)=O)CC(C)C)=O)=O)=O)=O)C)=O)C)=O)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)CC5=CC=CC=C5)=O)=O)C)=O)=O.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C167H270N52O46.C2HF3O2/c1-16-86(10)131(162(263)201-105(39-24-29-63-172)145(246)208-117(74-125(176)229)153(254)197-103(37-22-27-61-170)140(241)196-107(41-31-65-187-166(181)182)143(244)203-111(134(178)235)69-93-43-49-97(224)50-44-93)217-159(260)122(80-221)214-147(248)109(55-57-123(174)227)200-151(252)113(68-83(4)5)205-152(253)114(71-94-45-51-98(225)52-46-94)206-144(245)104(38-23-28-62-171)195-139(240)101(35-20-25-59-168)193-136(237)88(12)190-135(236)87(11)192-160(261)129(84(6)7)216-148(249)110(56-58-124(175)228)199-141(242)102(36-21-26-60-169)194-142(243)106(40-30-64-186-165(179)180)198-150(251)112(67-82(2)3)204-146(247)108(42-32-66-188-167(183)184)202-163(264)132(90(14)222)218-156(257)115(72-95-47-53-99(226)54-48-95)207-154(255)118(75-126(177)230)209-155(256)120(77-128(233)234)212-164(265)133(91(15)223)219-157(258)116(70-92-33-18-17-19-34-92)211-161(262)130(85(8)9)215-137(238)89(13)191-149(250)119(76-127(231)232)210-158(259)121(79-220)213-138(239)100(173)73-96-78-185-81-189-96;3-2(4,5)1(6)7/h17-19,33-34,43-54,78,81-91,100-122,129-133,220-226H,16,20-32,35-42,55-77,79-80,168-173H2,1-15H3,(H2,174,227)(H2,175,228)(H2,176,229)(H2,177,230)(H2,178,235)(H,185,189)(H,190,236)(H,191,250)(H,192,261)(H,193,237)(H,194,243)(H,195,240)(H,196,241)(H,197,254)(H,198,251)(H,199,242)(H,200,252)(H,201,263)(H,202,264)(H,203,244)(H,204,247)(H,205,253)(H,206,245)(H,207,255)(H,208,246)(H,209,256)(H,210,259)(H,211,262)(H,212,265)(H,213,239)(H,214,248)(H,215,238)(H,216,249)(H,217,260)(H,218,257)(H,219,258)(H,231,232)(H,233,234)(H4,179,180,186)(H4,181,182,187)(H4,183,184,188);(H,6,7)/t86-,87-,88-,89-,90+,91+,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,129-,130-,131-,132-,133-;/m0./s1
InChi Key
JIQKRJDXBDWPCS-WDCXZJHUSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $29

    Add

    5 mg

    $135

    Add

    10 mg

    $253

    Add

    25 mg

    $597

    Add
    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    BAY 55-9837 is a peptide vasoactive intestinal polypeptide receptor 2 (VPAC2) agonist.1 It binds to VPAC2 (Kd = 65 nM) and selectively induces cAMP production in CHO cells expressing human VPAC2 over VPAC1 or the PACAP type I (PAC1) receptor (EC50s = 0.4, 100, and >1,000 nM, respectively). BAY 55-9837 (100 nM) increases glucose-dependent insulin secretion in isolated rat and human pancreatic islets. In vivo, BAY 55-9837 enhances glucose-induced insulin secretion in fasted rats (ED50 = ~3 pmol/kg).

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Tsutsumi, M., Claus, T.H., Liang, Y., et al. A potent and highly selective VPAC2 agonist enhances glucose-induced insulin release and glucose disposal: A potential therapy for type 2 diabetes. Diabetes 51(5), 1453-1460 (2002).