A peptide agonist of GLP-1R and an active metabolite of GLP-1 (7-36) amide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

GLP-1 (9-36) amide (trifluoroacetate salt)

Item No. 36863

Technical Information
Formal Name
L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-L-argininamide, trifluoroacetate salt
Synonyms
  • Glucagon-like Peptide 1 (9-36) amide
Molecular Formula
C140H214N36O43 • XCF3COOH
Formula Weight
Purity
≥95%
A solid
Peptide Sequence
EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
DMSO: Soluble: ≥10 mg/ml
SMILES
N=C(N)NCCC[C@@H](C(N)=O)NC(CNC([C@H](CCCCN)NC([C@H](C(C)C)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](C)NC([C@H]([C@@H](C)CC)NC([C@@H](NC([C@H](CCC(O)=O)NC([C@H](CCCCN)NC([C@H](C)NC([C@H](C)NC([C@H](CCC(N)=O)NC(CNC([C@H](CCC(O)=O)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](CO)NC([C@H](CO)NC([C@H](C(C)C)NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H]([C@H](O)C)NC([C@@H](NC([C@H]([C@H](O)C)NC(CNC([C@@H](N)CCC(O)=O)=O)=O)=O)CC1=CC=CC=C1)=O)=O)=O)=O)=O)=O)=O)CC2=CC=C(C=C2)O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CC=CC=C3)=O)=O)=O)CC4=CNC5=CC=CC=C45)=O)=O)=O)=O)=O.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C140H214N36O43.C2HF3O2/c1-16-72(10)112(137(217)155-75(13)118(198)162-97(59-81-61-149-85-35-24-23-34-83(81)85)127(207)164-93(55-69(4)5)128(208)173-110(70(6)7)135(215)161-87(36-25-27-51-141)120(200)151-62-103(184)156-86(115(145)195)38-29-53-148-140(146)147)175-129(209)95(56-78-30-19-17-20-31-78)165-124(204)91(46-50-108(191)192)160-123(203)88(37-26-28-52-142)158-117(197)74(12)153-116(196)73(11)154-122(202)90(44-47-102(144)183)157-104(185)63-152-121(201)89(45-49-107(189)190)159-125(205)92(54-68(2)3)163-126(206)94(58-80-39-41-82(182)42-40-80)166-132(212)99(65-177)169-134(214)101(67-179)170-136(216)111(71(8)9)174-131(211)98(60-109(193)194)167-133(213)100(66-178)171-139(219)114(77(15)181)176-130(210)96(57-79-32-21-18-22-33-79)168-138(218)113(76(14)180)172-105(186)64-150-119(199)84(143)43-48-106(187)188;3-2(4,5)1(6)7/h17-24,30-35,39-42,61,68-77,84,86-101,110-114,149,177-182H,16,25-29,36-38,43-60,62-67,141-143H2,1-15H3,(H2,144,183)(H2,145,195)(H,150,199)(H,151,200)(H,152,201)(H,153,196)(H,154,202)(H,155,217)(H,156,184)(H,157,185)(H,158,197)(H,159,205)(H,160,203)(H,161,215)(H,162,198)(H,163,206)(H,164,207)(H,165,204)(H,166,212)(H,167,213)(H,168,218)(H,169,214)(H,170,216)(H,171,219)(H,172,186)(H,173,208)(H,174,211)(H,175,209)(H,176,210)(H,187,188)(H,189,190)(H,191,192)(H,193,194)(H4,146,147,148);(H,6,7)/t72-,73-,74-,75-,76+,77+,84-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,110-,111-,112-,113-,114-;/m0./s1
InChi Key
VYPASAXGAOYBFX-ADVUUXPKSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Wet ice in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Add

    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Glucagon-like peptide 1 (GLP-1) (9-36) amide is a peptide agonist of the GLP-1 receptor (GLP-1R) and an active metabolite of GLP-1 (7-36) amide (Item No. 15069).1,2 It is formed from GLP-1 (7-36) by dipeptidyl peptidase 4 (DPP-4).2 GLP-1 (9-36) amide induces cAMP accumulation in a reporter assay using HEK293 cells expressing human GLP-1R (EC50 = 309.03 µM).1 It reduces blood glucose levels in pigs when infused at a concentration of 2.55 pmol/kg per minute.3 Infusion of GLP-1 (9-36) amide (1.5 pmol/kg per minute) decreases left ventricle systolic pressure and end-diastolic pressure and heart contractility and rate in a dog model of dilated cardiomyopathy.4 It increases mean arterial blood pressure, stroke volume, myocardial glucose uptake, and plasma norepinephrine levels in the same model.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Li, N., Lu, J., and Willars, G.B. Allosteric modulation of the activity of the glucagon-like peptide-1 (GLP-1) metabolite GLP-1 9-36 amide at the GLP-1 receptor. PLoS One 7(10), e47936 (2012).

    2. Deacon, C.F., Johnsen, A.H., and Holst, J.J. Degradation of glucagon-like peptide-1 by human plasma in vitro yields an N-terminally truncated peptide that is a major endogenous metabolite in vivo. J. Clin. Endocrinol. Metab. 80(3), 952-957 (1995).

    3. Deacon, C.F., Plamboeck, A., Møller, S., et al. GLP-1-(9-36) amide reduces blood glucose in anesthetized pigs by a mechanism that does not involve insulin secretion. Am. J. Physiol. Endocrinol. Metab. 282(4), E873-E879 (2002).

    4. Nikolaidis, L.A., Elahi, D., Shen, Y.-T., et al. Active metabolite of GLP-1 mediates myocardial glucose uptake and improves left ventricular performance in conscious dogs with dilated cardiomyopathy. Am. J. Physiol. Heart. Circ. Physiol. 289(6), H2401-H2408 (2005).