A peptide incretin hormone
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Glucose-dependent Insulinotropic Polypeptide (1-42) (porcine) (trifluoroacetate salt)

Item No. 36905

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-tyrosyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysylglycyl-L-lysyl-L-lysyl-L-seryl-L-α-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparaginyl-L-isoleucyl-L-threonylL-tyrosyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysylglycyl-L-lysyl-L-lysyl-L-seryl-L-α-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-glutamine, trifluoroacetate salt
Synonyms
  • Gastric Inhibitory Peptide (1-42)
  • GIP (1-42)
Molecular Formula
C225H342N60O66S • XCF3COOH
Formula Weight
4975.6
Purity
≥98%
Formulation (Request formulation change)
A solid
Peptide Sequence
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ-OH
Solubility(Learn about Variance in Solubility)
Water: Soluble
SMILES
O=C(N[C@H](C(N[C@@H](CCC(O)=O)C(NCC(N[C@]([C@H](O)C)([H])C(N[C@H](C(N[C@@](C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](CC1=CC=C(O)C=C1)C(N[C@@H](CO)C(N[C@@](C(N[C@H](C(N[C@@H](CCSC)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCCN[H])C(N[C@@](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CC2=CNC3=C2C=CC=C3)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN[H])C(NCC(N[C@@H](CCCCN[H])C(N[C@@H](CCCCN[H])C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](CC4=CNC5=C4C=CC=C5)C(N[C@@H](CCCCN[H])C(N[C@@H](CC6=CNC=N6)C(N[C@@H](CC(N)=O)C(N[C@@](C(N[C@]([C@H](O)C)([H])C(N[C@@H](CCC(N)=O)C(O)=O)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)C)=O)CC(C)C)=O)CC(C)C)=O)=O)=O)=O)CC7=CC=CC=C7)=O)=O)=O)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)C)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)=O)([H])[C@@H](C)CC)=O)CC8=CC=CC=C8)=O)=O)=O)=O)C)[C@H](CC9=CC=C(O)C=C9)N[H].OC(C(F)(F)F)=O
InChi Code
InChI=1S/C225H342N60O66S.C2HF3O2/c1-21-113(11)179(284-216(342)164(108-288)277-202(328)150(91-125-62-66-130(292)67-63-125)264-209(335)160(99-176(307)308)273-215(341)163(107-287)278-220(346)181(115(13)23-3)282-212(338)152(90-123-48-29-26-30-49-123)274-222(348)183(120(18)289)279-172(300)105-245-190(316)142(72-77-173(301)302)251-185(311)117(15)247-188(314)133(231)88-124-60-64-129(291)65-61-124)218(344)249-119(17)187(313)253-146(78-85-352-20)198(324)271-158(97-174(303)304)207(333)257-140(58-39-44-83-230)199(325)281-180(114(12)22-2)219(345)260-141(59-45-84-241-225(238)239)192(318)258-144(69-74-166(233)294)196(322)259-145(70-75-167(234)295)197(323)270-159(98-175(305)306)208(334)265-151(89-122-46-27-25-28-47-122)211(337)280-178(112(9)10)217(343)275-156(95-169(236)297)206(332)266-154(93-127-102-243-135-53-34-32-51-132(127)135)204(330)263-149(87-111(7)8)201(327)262-148(86-110(5)6)200(326)248-118(16)186(312)252-143(68-73-165(232)293)195(321)254-136(54-35-40-79-226)189(315)244-104-171(299)250-137(55-36-41-80-227)191(317)255-139(57-38-43-82-229)194(320)276-162(106-286)214(340)272-161(100-177(309)310)210(336)267-153(92-126-101-242-134-52-33-31-50-131(126)134)203(329)256-138(56-37-42-81-228)193(319)268-155(94-128-103-240-109-246-128)205(331)269-157(96-170(237)298)213(339)283-182(116(14)24-4)221(347)285-184(121(19)290)223(349)261-147(224(350)351)71-76-168(235)296;3-2(4,5)1(6)7/h25-34,46-53,60-67,101-103,109-121,133,136-164,178-184,242-243,286-292H,21-24,35-45,54-59,68-100,104-108,226-231H2,1-20H3,(H2,232,293)(H2,233,294)(H2,234,295)(H2,235,296)(H2,236,297)(H2,237,298)(H,240,246)(H,244,315)(H,245,316)(H,247,314)(H,248,326)(H,249,344)(H,250,299)(H,251,311)(H,252,312)(H,253,313)(H,254,321)(H,255,317)(H,256,329)(H,257,333)(H,258,318)(H,259,322)(H,260,345)(H,261,349)(H,262,327)(H,263,330)(H,264,335)(H,265,334)(H,266,332)(H,267,336)(H,268,319)(H,269,331)(H,270,323)(H,271,324)(H,272,340)(H,273,341)(H,274,348)(H,275,343)(H,276,320)(H,277,328)(H,278,346)(H,279,300)(H,280,337)(H,281,325)(H,2
InChi Key
FLAIANSDJCUNJQ-OTRUTQRZSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $66

    Add

    5 mg

    $246

    Add

    10 mg

    $457

    Add
    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Glucose-dependent Insulinotropic Polypeptide (GIP) (1-42) is an endogenous 42-amino acid peptide incretin hormone that induces insulin secretion.1,2 It is expressed in intestinal neuroendocrine K cells and the submandibular gland and is released into circulation postprandially. GIP (1-42) inhibits histamine, pentagastrin, and insulin-induced gastric acid and pepsin secretion, increases glucose-induced insulin release, and stimulates gastric emptying in rats.3

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Fehmann, H.-C., and Göke, B. Characterization of GIP(1-30) and GIP(1-42) as stimulators of proinsulin gene transcription. Peptides 16(6), 1149-1152 (1995).

    2. Siskos, A.P., Katsila, T., Balafas, E., et al. Simultaneous absolute quantification of the glucose-dependent insulinotropic polypeptides GIP1-42 and GIP3-42 in mouse plasma by LC/ESI-MS/MS: Preclinical evaluation of DP-IV inhibitors. J. Proteome Res. 8(7), 3487-3496 (2009).

    3. Rossowski, W.J., Zacharia, S., Mungan, Z., et al. Reduced gastric acid inhibitory effect of a pGIP(1-30)NH2 fragment with potent pancreatic amylase inhibitory activity. Regul. Pept. 39(1), 9-17 (1992).