A GLP-1R agonist and active metabolite of exendin-4 (48-86) amide
Related Products
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Exendin-4 (3-39) amide (trifluoroacetate salt)

Item No. 36912

Technical Information
Formal Name
L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-prolyl-L-prolyl-L-serinamide, trifluoroacetate salt
Synonyms
  • Exendin (3-39)
Molecular Formula
C176H272N46O58S • XCF3COOH
Formula Weight
Purity
≥90%
A solid
Peptide Sequence
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Methanol: SolubleWater: Soluble
SMILES
OC(C(F)(F)F)=O.OC(C[C@H](NC([C@H](CO)NC([C@]([H])([C@@H](C)O)NC([C@@H](NC([C@]([H])([C@@H](C)O)NC(CNC([C@H](CCC(O)=O)N[H])=O)=O)=O)CC1=CC=CC=C1)=O)=O)=O)C(N[C@H](C(N[C@@H](CO)C(N[C@@H](CCCCN[H])C(N[C@@H](CCC(N)=O)C(N[C@@H](CCSC)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@H](C(N[C@@](C(N[C@@H](CCC(O)=O)C(N[C@@H](CC2=CNC3=C2C=CC=C3)C(N[C@H](C(N[C@@H](CCCCN[H])C(N[C@@H](CC(N)=O)C(NCC(NCC(N4CCC[C@H]4C(N[C@@H](CO)C(N[C@@H](CO)C(NCC(N[C@H](C(N5CCC[C@H]5C(N6CCC[C@H]6C(N7CCC[C@H]7C(N[C@@H](CO)C(N)=O)=O)=O)=O)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC(C)C)=O)=O)=O)([H])[C@H](CC)C)=O)CC8=CC=CC=C8)=O)CC(C)C)=O)=O)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)CC(C)C)=O)=O
InChi Code
InChI=1S/C176H272N46O58S.C2HF3O2/c1-16-90(10)140(170(275)201-108(52-58-137(244)245)155(260)206-115(73-97-76-186-100-39-24-23-38-98(97)100)160(265)203-110(68-86(2)3)157(262)193-102(41-26-28-61-178)150(255)207-116(74-128(181)231)146(251)189-77-129(232)187-80-132(235)219-63-30-43-123(219)167(272)213-121(84-226)166(271)211-119(82-224)147(252)190-78-130(233)191-92(12)173(278)221-65-32-45-125(221)175(280)222-66-33-46-126(222)174(279)220-64-31-44-124(220)168(273)210-118(81-223)143(182)248)217-162(267)113(71-95-34-19-17-20-35-95)205-158(263)111(69-87(4)5)202-151(256)103(42-29-62-185-176(183)184)200-169(274)139(89(8)9)216-144(249)91(11)192-148(253)105(49-55-134(238)239)196-153(258)106(50-56-135(240)241)197-154(259)107(51-57-136(242)243)198-156(261)109(59-67-281-15)199-152(257)104(48-53-127(180)230)195-149(254)101(40-25-27-60-177)194-164(269)120(83-225)212-159(264)112(70-88(6)7)204-161(266)117(75-138(246)247)208-165(270)122(85-227)214-172(277)142(94(14)229)218-163(268)114(72-96-36-21-18-22-37-96)209-171(276)141(93(13)228)215-131(234)79-188-145(250)99(179)47-54-133(236)237;3-2(4,5)1(6)7/h17-24,34-39,76,86-94,99,101-126,139-142,186,223-229H,16,25-33,40-75,77-85,177-179H2,1-15H3,(H2,180,230)(H2,181,231)(H2,182,248)(H,187,232)(H,188,250)(H,189,251)(H,190,252)(H,191,233)(H,192,253)(H,193,262)(H,194,269)(H,195,254)(H,196,258)(H,197,259)(H,198,261)(H,199,257)(H,200,274)(H,201,275)(H,202,256)(H,203,265)(H,204,266)(H,205,263)(H,206,260)(H,207,255)(H,208,270)(H,209,276)(H,210,273)(H,211,271)(H,212,264)(H,213,272)(H,214,277)(H,215,234)(H,216,249)(H,217,267)(H,218,268)(H,236,237)(H,238,239)(H,240,241)(H,242,243)(H,244,245)(H,246,247)(H4,183,184,185);(H,6,7)/t90-,91-,92-,93+,94+,99-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,139-,140-,141-,142-;/m0./s1
InChi Key
KGMYYEONFAMZOW-BNSREOSNSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Exendin-4 (3-39) amide is an agonist of glucagon-like peptide 1 receptor (GLP-1R) and an active metabolite of exendin-4 (48-86) amide (Item No. 11096).1,2 It is formed from exendin-4 (48-86) amide in rat liver homogenates.2 Exendin-4 (3-39) amide induces cAMP accumulation in HEK293 cells expressing human GLP-1R (EC50 = 9 nM).1

    WARNING This product is not for human or veterinary use.