An antiviral peptide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

P9R (trifluoroacetate salt)

Item No. 37463

Technical Information
Formal Name
L-asparaginylglycyl-L-alanyl-L-isoleucyl-L-cysteinyl-L-tryptophylglycyl-L-prolyl-L-cysteinyl-L-prolyl-L-threonyl-L-alanyl-L-phenylalanyl-L-arginyl-L-glutaminyl-L-isoleucylglycyl-L-asparaginyl-L-cysteinylglycyl-L-arginyl-L-phenylalanyl-L-arginyl-L-valyl-L-arginyl-L-cysteinyl-L-cysteinyl-L-arginyl-L-isoleucyl-L-arginine, trifluoroacetate
Molecular Formula
C144H232N52O35S5 • XCF3COOH
Formula Weight
Purity
≥95%
A solid
Peptide Sequence
NGAICWGPCPTAFRQIGNCGRFRVRCCRIR-OH
Water: Soluble
SMILES
OC(C(F)(F)F)=O.O=C(NCC(N[C@H](C(N[C@@](C(N[C@@H](CS[H])C(N[C@@H](CC1=CNC2=C1C=CC=C2)C(NCC(N3CCC[C@H]3C(N[C@@H](CS[H])C(N4CCC[C@H]4C(N[C@]([C@H](O)C)([H])C(N[C@H](C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@](C(NCC(N[C@@H](CC(N)=O)C(N[C@@H](CS[H])C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CS[H])C(N[C@@H](CS[H])C(N[C@@H](CCCNC(N)=N)C(N[C@@](C(N[C@@H](CCCNC(N)=N)C(O)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)=O)=O)=O)CC5=CC=CC=C5)=O)=O)=O)=O)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)CC6=CC=CC=C6)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)([H])[C@@H](C)CC)=O)C)=O)[C@H](CC(N)=O)N[H]
InChi Code
InChI=1S/C144H232N52O35S5.C2HF3O2/c1-12-71(6)109(192-123(215)88(45-46-101(146)198)179-119(211)84(38-24-48-162-140(151)152)176-124(216)90(55-77-31-17-15-18-32-77)182-113(205)75(10)173-136(228)112(76(11)197)194-131(223)100-44-30-54-196(100)137(229)98(69-236)189-130(222)99-43-29-53-195(99)107(204)64-171-116(208)92(57-79-60-167-82-36-22-21-35-80(79)82)184-128(220)97(68-235)188-135(227)110(72(7)13-2)191-114(206)74(9)172-104(201)61-168-115(207)81(145)58-102(147)199)132(224)170-63-106(203)175-93(59-103(148)200)126(218)185-94(65-232)117(209)169-62-105(202)174-83(37-23-47-161-139(149)150)118(210)183-91(56-78-33-19-16-20-34-78)125(217)177-86(40-26-50-164-142(155)156)121(213)190-108(70(4)5)133(225)180-85(39-25-49-163-141(153)154)120(212)186-96(67-234)129(221)187-95(66-233)127(219)178-87(41-27-51-165-143(157)158)122(214)193-111(73(8)14-3)134(226)181-89(138(230)231)42-28-52-166-144(159)160;3-2(4,5)1(6)7/h15-22,31-36,60,70-76,81,83-100,108-112,167,197,232-236H,12-14,23-30,37-59,61-69,145H2,1-11H3,(H2,146,198)(H2,147,199)(H2,148,200)(H,168,207)(H,169,209)(H,170,224)(H,171,208)(H,172,201)(H,173,228)(H,174,202)(H,175,203)(H,176,216)(H,177,217)(H,178,219)(H,179,211)(H,180,225)(H,181,226)(H,182,205)(H,183,210)(H,184,220)(H,185,218)(H,186,212)(H,187,221)(H,188,227)(H,189,222)(H,190,213)(H,191,206)(H,192,215)(H,193,214)(H,194,223)(H,230,231)(H4,149,150,161)(H4,151,152,162)(H4,153,154,163)(H4,155,156,164)(H4,157,158,165)(H4,159,160,166);(H,6,7)/t71-,72-,73-,74-,75-,76+,81-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,108-,109-,110-,111-,112-;/m0./s1
InChi Key
XKJROCKISJSYAJ-GKABRGBASA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Cayman Chemical
    Neutrophil Biology Wall Poster

    Explore how neutrophils shape the immune response in health and disease. This poster highlights neutrophil pathogen defense mechanisms, including phagocytosis, degranulation, and NETosis, as well as neutrophil roles in inflammation and NET-associated pathologies.

    DOWNLOAD NOW
    Product Description

    P9R is a peptide with antiviral activity.1 It inhibits viral replication of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), Middle East respiratory syndrome coronavirus (MERS-CoV), SARS-CoV, influenza A subtypes H1N1 and H7N9, and rhinovirus in plaque reduction assays (IC50s = 0.9, 2.2, 4.2, 0.6, 0.9, and 5.7 µg/ml, respectively). In vivo, P9R (50 µg/animal three times over two days) increases survival and reduces H1N1 particle-forming units (PFUs) in the lungs to a similar extent as the influenza neuraminidase inhibitor zanamivir (Item No. 15123) in H1N1-infected mice.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Zhao, H., To, K.K.W., Sze, K.-H., et alA broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2. Nat. Commun. 11(1), 4252 (2020).