A negative control for LL-37 (human)
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

LL-37 (human) (scrambled) (trifluoroacetate salt)

Item No. 37503

Technical Information
Synonyms
  • Cathelicidin
  • CAP-18
  • FALL-39
  • hCAP-18
Molecular Formula
C205H340N60O53 • XCF3COOH
Formula Weight
Purity
≥95%
A solid
Peptide Sequence
H-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR-OH
Water: Soluble
SMILES
[H]NCC(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@]([C@@H](C)O)([H])C(N1CCC[C@H]1C(N[C@@H](CCC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@H](C(N[C@@H](CC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CO)C(N[C@@H](C(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(O)=O)=O)=O)=O)=O)=O)=O)=O)CC(O)=O)=O)=O)=O)=O)=O)CC(O)=O)=O)=O)CC2=CC=CC=C2)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CC=CC=C3)=O)=O)=O)=O)=O)=O)=O)CC4=CC=CC=C4)=O)=O)CC5=CC=CC=C5)=O)=O)=O)=O)=O.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C205H340N60O53.C2HF3O2/c1-20-114(16)162(261-176(293)126(65-39-45-85-210)239-191(308)148(106-266)257-187(304)144(100-121-59-33-26-34-60-121)253-175(292)134(75-79-156(275)276)240-185(302)142(98-119-55-29-24-30-56-119)250-170(287)128(67-47-87-225-201(215)216)236-182(299)139(95-110(8)9)247-167(284)123(62-36-42-82-207)233-180(297)137(93-108(4)5)232-153(271)104-212)196(313)242-122(61-35-41-81-206)166(283)230-105-154(272)231-132(74-78-155(273)274)173(290)252-143(99-120-57-31-25-32-58-120)186(303)249-140(96-111(10)11)183(300)235-127(66-40-46-86-211)178(295)264-165(117(19)268)199(316)265-92-52-72-150(265)193(310)241-135(76-80-157(277)278)179(296)259-160(112(12)13)194(311)243-130(69-49-89-227-203(219)220)172(289)251-141(97-118-53-27-23-28-54-118)184(301)237-129(68-48-88-226-202(217)218)171(288)256-147(103-159(281)282)190(307)263-163(115(17)21-2)197(314)244-125(64-38-44-84-209)169(286)248-138(94-109(6)7)181(298)234-124(63-37-43-83-208)168(285)255-146(102-158(279)280)189(306)254-145(101-152(214)270)188(305)238-131(70-50-90-228-204(221)222)177(294)262-164(116(18)22-3)198(315)258-149(107-267)192(309)260-161(113(14)15)195(312)245-133(73-77-151(213)269)174(291)246-136(200(317)318)71-51-91-229-205(223)224;3-2(4,5)1(6)7/h23-34,53-60,108-117,122-150,160-165,266-268H,20-22,35-52,61-107,206-212H2,1-19H3,(H2,213,269)(H2,214,270)(H,230,283)(H,231,272)(H,232,271)(H,233,297)(H,234,298)(H,235,300)(H,236,299)(H,237,301)(H,238,305)(H,239,308)(H,240,302)(H,241,310)(H,242,313)(H,243,311)(H,244,314)(H,245,312)(H,246,291)(H,247,284)(H,248,286)(H,249,303)(H,250,287)(H,251,289)(H,252,290)(H,253,292)(H,254,306)(H,255,285)(H,256,288)(H,257,304)(H,258,315)(H,259,296)(H,260,309)(H,261,293)(H,262,294)(H,263,307)(H,264,295)(H,273,274)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,317,318)(H4,215,216,225)(H4,217,218,226)(H4,219,220,227)(H4,221,222,228)(H4,223,224,229);(H,6,7)/t114-,115-,116-,117+,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,14
InChi Key
IOEGRGHNRUSGOA-YLLLKHBJSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Cayman Chemical
    Neutrophil Biology Wall Poster

    Explore how neutrophils shape the immune response in health and disease. This poster highlights neutrophil pathogen defense mechanisms, including phagocytosis, degranulation, and NETosis, as well as neutrophil roles in inflammation and NET-associated pathologies.

    DOWNLOAD NOW
    Product Description

    LL-37 (human) (scrambled) is a synthetic peptide with identical amino acid composition to LL-37 (human) (Item No. 24461). It has been used as a negative control for LL-37 (human) in various antimicrobial assays.1

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Sheehan, G., Bergsson, G., McElvaney, N.G., et alThe human cathelicidin antimicrobial peptide LL-37 promotes the growth of the pulmonary pathogen Aspergillus fumigatus. Infect. Immun. 86(7), e0097-0018 (2018).