An endogenous incretin hormone
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

GLP-1 (1-32) (bullfrog) (trifluoroacetate salt)

Item No. 40718

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-histidyl-L-alanyl-L-α-aspartylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-methionyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamyl-L-α-glutamyl-L-lysyl-L-alanyl-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-valyl-L-α-aspartyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-lysylglycyl-L-arginyl-prolyl-L-lysinamide, trifluoroacetate salt
Synonyms
  • Glucagon-like Peptide 1 (1-32)
Molecular Formula
C164H250N42O51S • XCF3COOH
Formula Weight
3658.1
Purity
≥98%
Formulation (Request formulation change)
A solid
Peptide Sequence
HADGTFTSDMSSYLEEKAAKEFVDWLIKGRPK-NH2
Solubility(Learn about Variance in Solubility)
DMSO: Soluble: ≥10 mg/mlEthanol: Sparingly soluble: 1-10 mg/mlPBS (pH 7.2): Soluble: ≥10 mg/ml
SMILES
O=C(N[C@H](C(N[C@@H](CC(O)=O)C(NCC(N[C@]([C@H](O[H])C)([H])C(N[C@H](C(N[C@]([C@H](O[H])C)([H])C(N[C@@H](CO[H])C(N[C@@H](CC(O)=O)C(N[C@@H](CCSC)C(N[C@@H](CO[H])C(N[C@@H](CO[H])C(N[C@@H](CC1=CC=C(O[H])C=C1)C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCCN[H])C(N[C@H](C(N[C@H](C(N[C@@H](CCCCN[H])C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC2=CN([H])C3=C2C=CC=C3)C(N[C@H](C(N[C@@](C(N[C@@H](CCCCN[H])C(NCC(N[C@@H](CCC/N=C(N[H])/N)C(N4CCC[C@H]4C(N[C@@H](CCCCN[H])C(O)=O)=O)=O)=O)=O)=O)([H])[C@@H](C)CC)=O)CC(C)C)=O)=O)=O)=O)CC5=CC=CC=C5)=O)=O)=O)C)=O)C)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)=O)CC6=CC=CC=C6)=O)=O)=O)=O)C)[C@H](CC7=CN([H])C=N7)N[H].FC(F)(F)C(O)=O
InChi Code
InChI=1S/C164H250N42O51S.C2HF3O2/c1-15-85(8)131(159(252)188-100(40-24-28-57-165)138(231)175-76-122(213)181-107(44-32-61-173-164(170)171)162(255)206-62-33-45-121(206)157(250)189-108(163(256)257)43-27-31-60-168)204-151(244)110(65-83(4)5)192-148(241)114(69-94-74-174-99-39-23-22-38-97(94)99)195-150(243)117(73-129(225)226)198-158(251)130(84(6)7)203-152(245)112(66-91-34-18-16-19-35-91)193-144(237)105(52-55-126(219)220)184-141(234)102(42-26-30-59-167)182-135(228)87(10)178-134(227)86(9)180-140(233)101(41-25-29-58-166)183-142(235)103(50-53-124(215)216)185-143(236)104(51-54-125(217)218)186-146(239)109(64-82(2)3)191-147(240)111(68-93-46-48-96(212)49-47-93)194-154(247)118(78-207)200-156(249)119(79-208)199-145(238)106(56-63-258-14)187-149(242)116(72-128(223)224)196-155(248)120(80-209)201-161(254)133(90(13)211)205-153(246)113(67-92-36-20-17-21-37-92)197-160(253)132(89(12)210)202-123(214)77-176-139(232)115(71-127(221)222)190-136(229)88(11)179-137(230)98(169)70-95-75-172-81-177-95;3-2(4,5)1(6)7/h16-23,34-39,46-49,74-75,81-90,98,100-121,130-133,174,207-212H,15,24-33,40-45,50-73,76-80,165-169H2,1-14H3,(H,172,177)(H,175,231)(H,176,232)(H,178,227)(H,179,230)(H,180,233)(H,181,213)(H,182,228)(H,183,235)(H,184,234)(H,185,236)(H,186,239)(H,187,242)(H,188,252)(H,189,250)(H,190,229)(H,191,240)(H,192,241)(H,193,237)(H,194,247)(H,195,243)(H,196,248)(H,197,253)(H,198,251)(H,199,238)(H,200,249)(H,201,254)(H,202,214)(H,203,245)(H,204,244)(H,205,246)(H,215,216)(H,217,218)(H,219,220)(H,221,222)(H,223,224)(H,225,226)(H,256,257)(H4,170,171,173);(H,6,7)/t85-,86-,87-,88-,89+,90+,98-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,130-,131-,132-,133-;/m0./s1
InChi Key
CBDXUTXDBNQVBN-BLFFMKPPSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $28

    Add

    5 mg

    $125

    Add

    10 mg

    $220

    Add

    25 mg

    $482

    Add
    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Glucagon-like peptide 1 (GLP-1) (1-32) is an endogenous incretin hormone.1 It increases intracellular cAMP levels using HEK293 cells expressing human GLP-1 receptor (GLP-1R; EC50 = 0.051 nM). In vivo, GLP-1 (1-32) (30 mg/kg) reduces blood glucose levels in an oral glucose tolerance test (OGTT) in fasted mice.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Jiang, N., Su, D., Chen, D., et al. Discovery of a novel glucagon-like peptide-1 (GLP-1) analogue from bullfrog and investigation of its potential for designing GLP-1-based multiagonists. J. Med. Chem. 67(1), 180-198 (2024).