A derivative of GLP-1 (7-36) amide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

GLP-1 (7-36) Acid (human, mouse, rat, porcine, bovine)

Item No. 41250

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-histidyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-L-arginine, monoacetate
Synonyms
  • Glucagon-like Peptide 1 (7-36) Acid
  • Beinaglutide
Molecular Formula
C149H225N39O46 • C2H4O2
Formula Weight
3358.7
Purity
≥98%
Formulation (Request formulation change)
A solid
Peptide Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-OH
Solubility(Learn about Variance in Solubility)
DMSO: Sparingly soluble: 1-10 mg/mlPBS (pH 7.2): Slightly soluble: 0.1-1 mg/ml
SMILES
OC(CC[C@H](NC([C@@H](NC([C@H](CC1=CN(C=N1)[H])N[H])=O)C)=O)C(NCC(N[C@@]([H])([C@@H](C)O[H])C(N[C@H](C(N[C@@]([H])([C@@H](C)O[H])C(N[C@@H](CO[H])C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CO[H])C(N[C@@H](CO[H])C(N[C@@H](CC(C=C2)=CC=C2O[H])C(N[C@H](C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCC(N[H])=O)C(N[C@H](C(N[C@H](C(N[C@@H](CCCCN[H])C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@@](C(N[C@H](C(N[C@@H](CC3=CN([H])C4=C3C=CC=C4)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CCCCN[H])C(NCC(N[C@@H](CCC/N=C(N)\N[H])C(O)=O)=O)=O)=O)=O)CC(C)C)=O)=O)C)=O)([H])[C@H](CC)C)=O)CC5=CC=CC=C5)=O)=O)=O)C)=O)C)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)=O)CC6=CC=CC=C6)=O)=O)=O)=O.CC(O)=O
InChi Code
InChI=1S/C149H225N39O46.C2H4O2/c1-17-76(10)119(145(230)166-80(14)125(210)174-104(60-86-63-158-91-36-25-24-35-89(86)91)135(220)176-100(56-73(4)5)136(221)185-117(74(6)7)143(228)173-92(37-26-28-52-150)127(212)159-66-111(197)168-98(148(233)234)39-30-54-157-149(154)155)187-137(222)102(57-83-31-20-18-21-32-83)177-132(217)97(47-51-115(203)204)172-131(216)93(38-27-29-53-151)169-123(208)78(12)163-122(207)77(11)165-130(215)96(44-48-109(153)195)167-110(196)65-160-129(214)95(46-50-114(201)202)171-133(218)99(55-72(2)3)175-134(219)101(59-85-40-42-88(194)43-41-85)178-140(225)106(68-189)181-142(227)108(70-191)182-144(229)118(75(8)9)186-139(224)105(62-116(205)206)179-141(226)107(69-190)183-147(232)121(82(16)193)188-138(223)103(58-84-33-22-19-23-34-84)180-146(231)120(81(15)192)184-112(198)67-161-128(213)94(45-49-113(199)200)170-124(209)79(13)164-126(211)90(152)61-87-64-156-71-162-87;1-2(3)4/h18-25,31-36,40-43,63-64,71-82,90,92-108,117-121,158,189-194H,17,26-30,37-39,44-62,65-70,150-152H2,1-16H3,(H2,153,195)(H,156,162)(H,159,212)(H,160,214)(H,161,213)(H,163,207)(H,164,211)(H,165,215)(H,166,230)(H,167,196)(H,168,197)(H,169,208)(H,170,209)(H,171,218)(H,172,216)(H,173,228)(H,174,210)(H,175,219)(H,176,220)(H,177,217)(H,178,225)(H,179,226)(H,180,231)(H,181,227)(H,182,229)(H,183,232)(H,184,198)(H,185,221)(H,186,224)(H,187,222)(H,188,223)(H,199,200)(H,201,202)(H,203,204)(H,205,206)(H,233,234)(H4,154,155,157);1H3,(H,3,4)/t76-,77-,78-,79-,80-,81+,82+,90-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,117-,118-,119-,120-,121-;/m0./s1
InChi Key
MXSJMFDEQOORPM-AMEUXXCWSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $50

    Add

    5 mg

    $236

    Add

    10 mg

    $422

    Add

    25 mg

    $929

    Add
    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Glucagon-like peptide 1 (GLP-1) (7-36) acid is a derivative of the hormone and GLP-1 receptor (GLP-1R) agonist GLP-1 (7-36) amide.1,2 It enhances insulin-induced phosphorylation of Akt in 3T3-L1 adipocytes when used at a concentration of 100 nM in the presence of a dipeptidyl peptidase 4 (DPP-4) inhibitor.2 GLP-1 (7-36) acid (150 µg/kg) reduces plasma levels of total cholesterol, triglycerides, free fatty acids, LDL, insulin, and leptin, as well as adipose tissue weight, in a mouse model of obesity induced by a high-fat diet. It decreases blood glucose levels, food intake, and gastric emptying in non-obese and ob/ob mice when administered at a dose of 3 mg/kg.1

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Fang, X., Du, Z., Duan, C., et al. Beinaglutide shows significantly beneficial effects in diabetes/obesity-induced nonalcoholic steatohepatitis in ob/ob mouse model. Life Sci. 270:118966, (2021).

    2. Zhang, F., Chen, Z., Wu, D., et al. Recombinant human GLP-1 beinaglutide regulates lipid metabolism of adipose tissues in diet-induced obese mice. iScience 24(12), 103382 (2021).