A peptide agonist of GLP-1R and a derivative of GLP-1 (7-36) amide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

A8SGLP-1 (trifluoroacetate salt)

Item No. 41264

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-histidyl-L-seryl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-L-arginyl-glycinamide, trifuoroacetate salt
CAS Number
753024-08-7
Molecular Formula
C151H229N41O47 • XCF3COOH
Formula Weight
3370.7
Purity
≥98%
Formulation (Request formulation change)
A solid
Peptide Sequence
HSEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2
Solubility(Learn about Variance in Solubility)
DMSO: Sparingly soluble: 1-10 mg/mlEthanol: Soluble: ≥10 mg/mlPBS (pH 7.2): Sparingly soluble: 1-10 mg/ml
SMILES
[H]N[C@@H](CC1=CN=CN1)C(N[C@H](C(N[C@H](C(NCC(N[C@]([H])(C(N[C@@H](CC2=CC=CC=C2)C(N[C@]([H])(C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC3=CC=C(C=C3)O)C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@@H](C)C(N[C@@H](C)C(N[C@H](C(N[C@H](C(N[C@@H](CC4=CC=CC=C4)C(N[C@]([H])(C(N[C@@H](C)C(N[C@@H](CC5=CNC6=C5C=CC=C6)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(NCC(N)=O)=O)CCCNC(N)=N)=O)=O)CCCCN)=O)C(C)C)=O)CC(C)C)=O)=O)=O)[C@@H](C)CC)=O)=O)CCC(O)=O)=O)CCCCN)=O)=O)=O)CCC(N)=O)=O)=O)CCC(O)=O)=O)CC(C)C)=O)=O)CO)=O)CO)=O)C(C)C)=O)=O)CO)=O)[C@H](O)C)=O)=O)[C@H](O)C)=O)=O)CCC(O)=O)=O)CO)=O.O=C(O)C(F)(F)F
InChi Code
InChI=1S/C151H229N41O47.C2HF3O2/c1-16-77(10)121(148(237)169-80(13)126(215)177-104(59-86-62-161-91-35-24-23-34-89(86)91)137(226)179-100(55-74(4)5)138(227)189-119(75(6)7)146(235)176-93(36-25-27-51-152)129(218)163-65-112(202)170-92(38-29-53-160-151(157)158)128(217)162-64-111(156)201)191-139(228)102(56-83-30-19-17-20-31-83)180-134(223)98(46-50-117(209)210)175-133(222)94(37-26-28-52-153)172-125(214)79(12)167-124(213)78(11)168-132(221)97(43-47-110(155)200)171-113(203)66-164-130(219)95(44-48-115(205)206)173-135(224)99(54-73(2)3)178-136(225)101(58-85-39-41-88(199)42-40-85)181-143(232)107(69-194)185-145(234)109(71-196)186-147(236)120(76(8)9)190-141(230)105(61-118(211)212)182-144(233)108(70-195)187-150(239)123(82(15)198)192-140(229)103(57-84-32-21-18-22-33-84)183-149(238)122(81(14)197)188-114(204)67-165-131(220)96(45-49-116(207)208)174-142(231)106(68-193)184-127(216)90(154)60-87-63-159-72-166-87;3-2(4,5)1(6)7/h17-24,30-35,39-42,62-63,72-82,90,92-109,119-123,161,193-199H,16,25-29,36-38,43-61,64-71,152-154H2,1-15H3,(H2,155,200)(H2,156,201)(H,159,166)(H,162,217)(H,163,218)(H,164,219)(H,165,220)(H,167,213)(H,168,221)(H,169,237)(H,170,202)(H,171,203)(H,172,214)(H,173,224)(H,174,231)(H,175,222)(H,176,235)(H,177,215)(H,178,225)(H,179,226)(H,180,223)(H,181,232)(H,182,233)(H,183,238)(H,184,216)(H,185,234)(H,186,236)(H,187,239)(H,188,204)(H,189,227)(H,190,230)(H,191,228)(H,192,229)(H,205,206)(H,207,208)(H,209,210)(H,211,212)(H4,157,158,160);(H,6,7)/t77-,78-,79-,80-,81+,82+,90-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,119-,120-,121-,122-,123-;/m0./s1
InChi Key
BUWALRGZBJHKDN-QPCGZRJISA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $43

    Add

    5 mg

    $194

    Add

    10 mg

    $344

    Add

    25 mg

    $752

    Add
    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    A8SGLP-1 is a peptide agonist of glucagon-like peptide 1 receptor (GLP-1R) and a derivative of GLP-1 (7-36) amide (Item No. 15069).1 It induces cAMP accumulation in RIN T3 rat pancreatic insuloma cells (EC50 = 15 nM). Oral administration of lyophilized L. lactis expressing A8SGLP-1 reduces blood levels of glucose in the oral glucose tolerance test (OGTT), serum levels of Il-1β, Il-6, and Tnf-α, and fat mass in diabetic db/db mice.2

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Sarrauste de Menthière, C., Chavanieu, A., Grassy, G., et al. Structural requirements of the N-terminal region of GLP-1-[7-37]-NH2 for receptor interaction and cAMP production. Eur. J. Med. Chem. 39(6), 473-480 (2004).

    2. Zhang, H., Dong, M., Yuan, S., et al. Oral glucagon-like peptide 1 analogue ameliorates glucose intolerance in db/db mice. Biotechnol. Lett. 44(10), 1149-1162 (2022).