An amylin and calcitonin receptor agonist
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Cagrilintide (acetate)

Item No. 41329

Technical Information
Formal Name
N-(19-carboxy-1-oxononadecyl)-L-γ-glutamyl-L-lysyl-L-cysteinyl-L-asparaginyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanyl-L-α-glutamyl-L-phenylalanyl-L-leucyl-L-arginyl-L-histidyl-L-seryl-L-seryl-L-asparaginyl-L-asparaginyl-L-phenylalanylglycyl-L-prolyl-L-isoleucyl-L-leucyl-L-prolyl-L-prolyl-L-threonyl-L-asparaginyl-L-valylglycyl-L-seryl-L-asparaginyl-L-threonyl-L-prolinamide, cyclic (3→8)-disulfide, acetate salt
Synonyms
  • AM833
  • NN0174-0833
Molecular Formula
C194H312N54O59S2 • XC2H4O2
Formula Weight
Purity
≥98%
A solid
Peptide Sequence
(Eicosanedioic acid-γ-Glu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
DMSO: Slightly soluble: 0.1-1 mg/mlPBS (pH 7.2): Sparingly soluble: 1-10 mg/ml
SMILES
O=C([C@H]1N(CCC1)C([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@H]2N(CCC2)C([C@H]3N(CCC3)C([C@@H](NC([C@@H](NC([C@H]4N(CCC4)C(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC5=O)CC(N)=O)=O)[C@@H](C)O)=O)C)=O)[C@@H](C)O)=O)CSSC[C@@H]5NC([C@@H](NC(CC[C@H](NC(CCCCCCCCCCCCCCCCCCC(O)=O)=O)C(O)=O)=O)CCCCN)=O)=O)C)=O)[C@@H](C)O)=O)CCC(N)=O)=O)CCCNC(N)=N)=O)CC(C)C)=O)C)=O)CCC(O)=O)=O)CC6=CC=CC=C6)=O)CC(C)C)=O)CCCNC(N)=N)=O)CC7=CNC=N7)=O)CO)=O)CO)=O)CC(N)=O)=O)CC(N)=O)=O)CC8=CC=CC=C8)=O)=O)=O)[C@H](CC)C)=O)CC(C)C)=O)=O)=O)[C@@H](C)O)=O)CC(N)=O)=O)C(C)C)=O)=O)CO)=O)CC(N)=O)=O)[C@@H](C)O)=O)N.CC(O)=O
InChi Code
InChI=1S/C194H312N54O59S2.C2H4O2/c1-19-100(10)151(184(298)233-128(78-98(6)7)189(303)248-75-49-60-137(248)190(304)247-74-48-59-136(247)182(296)243-155(107(17)255)187(301)232-127(86-143(201)262)173(287)238-150(99(8)9)183(297)210-88-146(265)218-129(90-249)176(290)230-126(85-142(200)261)175(289)244-156(108(18)256)191(305)246-73-46-57-134(246)157(202)271)239-181(295)135-58-47-72-245(135)147(266)89-211-161(275)120(79-109-50-36-34-37-51-109)225-171(285)123(82-139(197)258)228-172(286)124(83-140(198)259)229-177(291)130(91-250)235-178(292)131(92-251)234-170(284)122(81-111-87-207-95-212-111)227-164(278)114(56-45-71-209-194(205)206)221-168(282)119(77-97(4)5)224-169(283)121(80-110-52-38-35-39-53-110)226-166(280)116(65-68-149(269)270)219-158(272)101(11)213-167(281)118(76-96(2)3)223-163(277)113(55-44-70-208-193(203)204)220-165(279)115(63-66-138(196)257)222-186(300)153(105(15)253)240-159(273)102(12)214-179(293)132-93-308-309-94-133(180(294)231-125(84-141(199)260)174(288)242-152(104(14)252)185(299)215-103(13)160(274)241-154(106(16)254)188(302)237-132)236-162(276)112(54-42-43-69-195)216-145(264)67-64-117(192(306)307)217-144(263)61-40-32-30-28-26-24-22-20-21-23-25-27-29-31-33-41-62-148(267)268;1-2(3)4/h34-39,50-53,87,95-108,112-137,150-156,249-256H,19-33,40-49,54-86,88-94,195H2,1-18H3,(H2,196,257)(H2,197,258)(H2,198,259)(H2,199,260)(H2,200,261)(H2,201,262)(H2,202,271)(H,207,212)(H,210,297)(H,211,275)(H,213,281)(H,214,293)(H,215,299)(H,216,264)(H,217,263)(H,218,265)(H,219,272)(H,220,279)(H,221,282)(H,222,300)(H,223,277)(H,224,283)(H,225,285)(H,226,280)(H,227,278)(H,228,286)(H,229,291)(H,230,290)(H,231,294)(H,232,301)(H,233,298)(H,234,284)(H,235,292)(H,236,276)(H,237,302)(H,238,287)(H,239,295)(H,240,273)(H,241,274)(H,242,288)(H,243,296)(H,244,289)(H,267,268)(H,269,270)(H,306,307)(H4,203,204,208)(H4,205,206,209);1H3,(H,3,4)/t100-,101-,102-,103-,104+,105+,106+,107+,108+,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,
InChi Key
ZVFSCEVVTIADGE-SXJCWIKGSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Cagrilintide is an agonist of amylin and calcitonin receptors and an acylated derivative of amylin.1,2 It binds to the amylin 3 receptor (AMY3; IC50 = 170 pM for the human receptor) and calcitonin receptor (IC50 = 223 pM for the human receptor). Cagrilintide activates human AMY3 and calcitonin receptors in reporter assays (EC50s = 49 and 62 pM, respectively). It increases cAMP accumulation in COS-1 cells expressing AMY1, AMY3, or calcitonin receptors (EC50s = 79.43, 114.82, and 43.65 nM, respectively).2 Cagrilintide (250 µM) has a low propensity for inducing amyloid fibril formation with a lag time of 45 hours in a thioflavin T assay.1 Cagrilintide reduces food intake in rats for at least 48 hours after administration of a single dose of 3 or 30 nmol/kg. It reduces body weight, food intake, and fat mass, but does not reduce blood glucose or increase blood insulin levels, in a mouse model of diet-induced obesity when administered at a dose of 100 nmol/kg.3

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Kruse, T., Hansen, J.L., Dahl, K., et alDevelopment of cagrilintide, a long-acting amylin analogue. J. Med. Chem. 64(15), 11183-11194 (2021).

    2. Fletcher, M.M., Keov, P., Truong, T.T., et alAM833 is a novel agonist of calcitonin family G protein-coupled receptors: Pharmacological comparison with six selective and nonselective agonists. J. Pharmacol. Exp. Ther. 77(3), 417-440 (2021).

    3. Sun, X., Yang, D., Li, Y., et alIdentification and utility exploration of a highly potent and long-acting bullfrog GLP-1 analogue in GLP-1 and amylin combination therapy. Peptides 177, 171203 (2024).