A peptide fragment of ACTH and an antagonist of MC2R
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

ACTH (7-38) (human) (trifluoroacetate salt)

Item No. 41547

Technical Information
Formal Name
31-L-serine-α7-38-corticotropin (swine), trifluoroacetate salt
Synonyms
  • Adrenocorticotropic Hormone (7-38)
  • α7-38-ACTH
  • CIP
  • Corticotropin Inhibitory Peptide
Molecular Formula
C167H257N47O46 • XCF3COOH
Formula Weight
Purity
≥95%
A solid
Peptide Sequence
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OH
DMSO: Soluble: ≥10 mg/mlPBS (pH 7.2): Soluble: ≥10 mg/ml
SMILES
O=C(N[C@@H](CCC/N=C(N[H])/N)C(N[C@@H](CC1=CN([H])C2=C1C=CC=C2)C(NCC(N[C@@H](CCCCN[H])C(N3CCC[C@H]3C(N[C@@H](C(C)C)C(NCC(N[C@@H](CCCCN[H])C(N[C@@H](CCCCN[H])C(N[C@@H](CCC/N=C(N[H])/N)C(N[C@@H](CCC/N=C(N[H])/N)C(N4CCC[C@H]4C(N[C@@H](C(C)C)C(N[C@@H](CCCCN[H])C(N[C@@H](C(C)C)C(N[C@@H](CC5=CC=C(O[H])C=C5)C(N6CCC[C@H]6C(N[C@@H](CC(N[H])=O)C(NCC(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CO[H])C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@H](C(N7CCC[C@H]7C(N[C@H](C(N[C@@H](CCC(O)=O)C(O)=O)=O)CC(C)C)=O)=O)CC8=CC=CC=C8)=O)C)=O)=O)C)=O)=O)=O)=O)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@@H](N[H])CC9=CC=CC=C9.O=C(O)C(F)(F)F
InChi Code
InChI=1S/C167H257N47O46.C2HF3O2/c1-87(2)75-113(150(245)200-112(164(259)260)59-63-131(227)228)203-153(248)120-48-31-73-213(120)162(257)117(77-95-37-16-13-17-38-95)205-138(233)93(11)188-142(237)107(56-60-128(221)222)192-137(232)92(10)189-152(247)119(86-215)207-148(243)109(58-62-130(225)226)197-151(246)116(81-132(229)230)202-147(242)108(57-61-129(223)224)193-136(231)91(9)187-125(218)83-184-141(236)115(80-124(173)217)204-154(249)121-49-32-74-214(121)163(258)118(78-96-52-54-98(216)55-53-96)206-159(254)134(89(5)6)208-149(244)104(43-22-26-66-170)198-158(253)135(90(7)8)210-156(251)123-51-34-72-212(123)161(256)111(47-30-70-182-167(178)179)199-145(240)106(46-29-69-181-166(176)177)196-144(239)103(42-21-25-65-169)195-143(238)102(41-20-24-64-168)190-126(219)85-186-157(252)133(88(3)4)209-155(250)122-50-33-71-211(122)160(255)110(44-23-27-67-171)191-127(220)84-185-140(235)114(79-97-82-183-101-40-19-18-39-99(97)101)201-146(241)105(45-28-68-180-165(174)175)194-139(234)100(172)76-94-35-14-12-15-36-94;3-2(4,5)1(6)7/h12-19,35-40,52-55,82,87-93,100,102-123,133-135,183,215-216H,20-34,41-51,56-81,83-86,168-172H2,1-11H3,(H2,173,217)(H,184,236)(H,185,235)(H,186,252)(H,187,218)(H,188,237)(H,189,247)(H,190,219)(H,191,220)(H,192,232)(H,193,231)(H,194,234)(H,195,238)(H,196,239)(H,197,246)(H,198,253)(H,199,240)(H,200,245)(H,201,241)(H,202,242)(H,203,248)(H,204,249)(H,205,233)(H,206,254)(H,207,243)(H,208,244)(H,209,250)(H,210,251)(H,221,222)(H,223,224)(H,225,226)(H,227,228)(H,229,230)(H,259,260)(H4,174,175,180)(H4,176,177,181)(H4,178,179,182);(H,6,7)/t91-,92-,93-,100-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,133-,134-,135-;/m0./s1
InChi Key
XPVLWMIZWOJXCW-LDRBROOYSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Add

    Product Description

    Adrenocorticotropic hormone (ACTH) (7-38) is a peptide fragment of ACTH (Item No. 24257) and an antagonist of melanocortin receptor 2 (MC2R), also known as the ACTH receptor.1 It inhibits ACTH-induced corticosterone production in isolated rat adrenal cells when used at concentrations of 0.455 or 4.55 µM. ACTH (7-38) also inhibits angiotensin-converting enzyme 1 (ACE1; IC50 = 750 nM for the dog enzyme).2 It inhibits basal cAMP secretion by isolated rat inner adrenocortical cells when used at a concentration of 1 µM.3 ACTH (7-38) induces hypotension in normotensive dogs (ED50 = 0.109 nmol/kg).4

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Li, C.H., Chung, D., Yamashiro, D., et alIsolation, characterization, and synthesis of a corticotropin-inhibiting peptide from human pituitary glands. Proc. Natl. Acad. Sci. U.S.A. 75(9), 4306-4309 (1978).

    2. Verma, P.S., Miller, R.L., Taylor, R.E., et alInhibition of canine lung angiotensin converting enzyme by ACTH and structurally related peptides. Biochem. Biophys. Res. Commun. 104(4), 1484-1488 (1982).

    3. Mazzocchi, G., Rebuffat, P., Gottardo, L., et alVasoactive intestinal peptide stimulates rat adrenal glucocorticoid secretion, through an ACTH receptor-dependent activation of the adenylate cyclase signaling pathway. Horm. Metab. Res. 30(5), 241-243 (1998).

    4. Tenner, T.E., Jr., Yang, C.M., Chang, J.K., et alPharmacological comparison of bPTH-(1-34) and other hypotensive peptides in the dog. Peptides 1(4), 285-288 (1980).