A derivative of hGHRH (1-44)
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Tesamorelin (acetate)

Item No. 42498

Technical Information
Formal Name
N-[(3E)-1-oxo-3-hexen-1-yl]-somatoliberin (human pancreatic islet), acetate
Synonyms
  • TH9507
  • N-hexanoyl-Tyr1 hGRF (1-44)
Molecular Formula
C221H366N72O67S • XC2H4O2
Formula Weight
Purity
≥98%
A solid
Peptide Sequence
X-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (where X = trans-3-hexenoyl)
PBS pH 7.2: Sparingly soluble: 1-10 mg/ml
SMILES
[H]N(C(C/C=C/CC)=O)[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@]([C@H](CC)C)([H])C(N[C@H](C(N[C@]([C@@H](C)O)([H])C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](C(C)C)C(N[C@@H](CC(C)C)C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(N)=O)C(N[C@H](C(N[C@]([C@H](CC)C)([H])C(N[C@H](C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(NCC(N[C@@H](CCC(O)=O)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N)=O)=O)=O)C)=O)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CCSC)=O)=O)CC(O)=O)=O)=O)=O)=O)=O)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC1=CC=C(O)C=C1)=O)=O)=O)=O)CC2=CC=CC=C2)=O)=O)C)=O)CC(O)=O)=O)C)=O)CC3=CC=C(O)C=C3.CC(O)=O
InChi Code
InChI=1S/C221H366N72O67S.C2H4O2/c1-25-28-30-53-163(308)260-145(92-120-54-58-122(299)59-55-120)198(343)255-116(21)179(324)276-150(96-169(316)317)199(344)256-117(22)180(325)291-172(111(16)26-2)214(359)284-147(91-119-43-31-29-32-44-119)206(351)293-174(118(23)298)215(360)285-149(95-162(230)307)205(350)289-155(104-297)210(355)280-146(93-121-56-60-123(300)61-57-121)203(348)267-130(51-41-83-248-220(240)241)186(331)266-126(46-34-36-78-223)197(342)290-171(110(14)15)212(357)283-141(87-106(6)7)183(328)252-100-166(311)258-133(63-70-157(225)302)190(335)278-144(90-109(12)13)202(347)288-152(101-294)208(353)257-115(20)178(323)262-128(49-39-81-246-218(236)237)185(330)265-125(45-33-35-77-222)189(334)277-143(89-108(10)11)201(346)279-142(88-107(8)9)200(345)272-137(66-73-160(228)305)195(340)282-151(97-170(318)319)207(352)292-173(112(17)27-3)213(358)274-139(76-85-361-24)196(341)287-153(102-295)209(354)268-131(52-42-84-249-221(242)243)187(332)270-135(64-71-158(226)303)192(337)269-132(62-69-156(224)301)182(327)251-99-165(310)259-134(67-74-167(312)313)191(336)286-154(103-296)211(356)281-148(94-161(229)306)204(349)273-136(65-72-159(227)304)193(338)271-138(68-75-168(314)315)194(339)264-124(47-37-79-244-216(232)233)181(326)250-98-164(309)253-113(18)176(321)261-127(48-38-80-245-217(234)235)184(329)254-114(19)177(322)263-129(50-40-82-247-219(238)239)188(333)275-140(175(231)320)86-105(4)5;1-2(3)4/h28-32,43-44,54-61,105-118,124-155,171-174,294-300H,25-27,33-42,45-53,62-104,222-223H2,1-24H3,(H2,224,301)(H2,225,302)(H2,226,303)(H2,227,304)(H2,228,305)(H2,229,306)(H2,230,307)(H2,231,320)(H,250,326)(H,251,327)(H,252,328)(H,253,309)(H,254,329)(H,255,343)(H,256,344)(H,257,353)(H,258,311)(H,259,310)(H,260,308)(H,261,321)(H,262,323)(H,263,322)(H,264,339)(H,265,330)(H,266,331)(H,267,348)(H,268,354)(H,269,337)(H,270,332)(H,271,338)(H,272,345)(H,273,349)(H,274,358)(H,275,333)(H,276,324)(H,277,334)(H,278,335)(H,279,346)(H,280,355)(H,281,356)(H,282,340)(H,283,357)(H,284,359)(H,285,360)(H,286,336)(H,287,341)(H,
InChi Key
LAJZPRPPHHRDIK-BCEXXFMNSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Add

    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Tesamorelin is a derivative of human growth hormone-releasing factor (1-44) (hGRF (1-44)) containing a hexanoyl adduct at the N-terminus, rendering it resistant to degradation by dipeptidyl peptidase 4 (DPP-4).1 In vivo, tesamorelin (20 µg/kg twice daily) increases serum levels of insulin-like growth factor 1 (IGF-1) in growing pigs.2 It also increases serum levels of growth hormone and IGF-1 in rats and dogs.1 Formulations containing tesamorelin have been used in the treatment of excess abdominal fat in adults with HIV and lipodystrophy.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Ferdinandi, E.S., Brazeau, P., High, K., et al. Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue. Basic Clin. Pharmacol. Toxicol. 100(1), 49-58 (2007).

    2. Dubreuil, P., and Désévaux, C. Growth hormone-releasing factor: Structural modification or protection for more potent analogs. Comb. Chem. High Throughput Screen. 9(3), 171-174 (2006).