A peptide fragment of albiglutide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Albiglutide Fragment (sodium salt)

Item No. 42542

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Formal Name
L-histidylglycyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-L-argininamide, sodium salt
Synonyms
  • GLP-1 Gly8
  • GLP-1 8-glycine
  • [Gly8]-GLP-1 (7-36) amide
Molecular Formula
C148H224N40O45 • XNa
Formula Weight
3283.6
Purity
≥95%
Formulation (Request formulation change)
A solid
Peptide Sequence
HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Solubility(Learn about Variance in Solubility)
Acetonitrile: Slightly Soluble: 0.1-1mg/ml
SMILES
[H]N[C@H](C(NCC(N[C@@H](CCC(O)=O)C(NCC(N[C@]([C@@H](C)O)([H])C(N[C@H](C(N[C@]([C@@H](C)O)([H])C(N[C@@H](CO)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCC(N)=O)C(N[C@H](C(N[C@H](C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@]([C@H](CC)C)([H])C(N[C@H](C(N[C@H](C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCCNC(N)=N)C(N)=O)=O)=O)=O)=O)=O)CC1=CNC2=C1C=CC=C2)=O)C)=O)=O)CC3=CC=CC=C3)=O)=O)=O)C)=O)C)=O)=O)=O)=O)=O)CC4=CC=C(O)C=C4)=O)=O)=O)=O)CC(O)=O)=O)=O)=O)CC5=CC=CC=C5)=O)=O)=O)=O)=O)CC6=CN=CN6.[Na]
InChi Code
InChI=1S/C148H224N40O45.Na/c1-16-76(10)119(145(231)166-79(13)125(211)174-103(59-85-62-158-90-35-24-23-34-88(85)90)135(221)176-99(55-73(4)5)136(222)185-117(74(6)7)143(229)173-92(36-25-27-51-149)127(213)160-65-109(196)167-91(122(153)208)38-29-53-157-148(154)155)187-137(223)101(56-82-30-19-17-20-31-82)177-132(218)97(46-50-115(204)205)172-131(217)93(37-26-28-52-150)170-124(210)78(12)164-123(209)77(11)165-130(216)96(43-47-108(152)195)169-111(198)66-161-129(215)95(45-49-114(202)203)171-133(219)98(54-72(2)3)175-134(220)100(58-84-39-41-87(194)42-40-84)178-140(226)105(68-189)181-142(228)107(70-191)182-144(230)118(75(8)9)186-139(225)104(61-116(206)207)179-141(227)106(69-190)183-147(233)121(81(15)193)188-138(224)102(57-83-32-21-18-22-33-83)180-146(232)120(80(14)192)184-112(199)67-162-128(214)94(44-48-113(200)201)168-110(197)64-159-126(212)89(151)60-86-63-156-71-163-86;/h17-24,30-35,39-42,62-63,71-81,89,91-107,117-121,158,189-194H,16,25-29,36-38,43-61,64-70,149-151H2,1-15H3,(H2,152,195)(H2,153,208)(H,156,163)(H,159,212)(H,160,213)(H,161,215)(H,162,214)(H,164,209)(H,165,216)(H,166,231)(H,167,196)(H,168,197)(H,169,198)(H,170,210)(H,171,219)(H,172,217)(H,173,229)(H,174,211)(H,175,220)(H,176,221)(H,177,218)(H,178,226)(H,179,227)(H,180,232)(H,181,228)(H,182,230)(H,183,233)(H,184,199)(H,185,222)(H,186,225)(H,187,223)(H,188,224)(H,200,201)(H,202,203)(H,204,205)(H,206,207)(H4,154,155,157);/t76-,77-,78-,79-,80+,81+,89-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,117-,118-,119-,120-,121-;/m0./s1
InChi Key
NXWDTJLOEFUTOJ-OPYNGVKNSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    1 mg

    $69

    Add

    5 mg

    $257

    Add

    10 mg

    $444

    Add

    25 mg

    $1,023

    Add
    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Albiglutide fragment is a peptide fragment of albiglutide, a fusion peptide with antidiabetic activity that contains two copies of [Gly8]-GLP-1 (7-36), which contains an alanine-to-glycine substitution that confers resistance to hydrolysis by dipeptidyl peptidase 4 (DPP-4), fused to albumin.1 Albiglutide fragment comprises one copy of the DPP-4-resistant [Gly8]-GLP-1 (7-36) sequence.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Rendell, M.S. Albiglutide: A unique GLP-1 receptor agonist. Expert Opin. Biol. Ther. 16(12), 1557-1569 (2016).