A peptide derivative of human IGF-1
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

IGF-1 LR3

Item No. 45532

Technical Information
Synonyms
  • IGF-1 Long Arginine 3
  • Long [Arg3]-IGF-I
  • LR3-IGF-I
Purity
≥95%
A solid
Peptide Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA-OH
DMSO: Sparingly soluble: 1-10 mg/mlWater: Sparingly soluble: 1-10 mg/ml
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Add

    Product Description

    IGF-1 long arginine 3 (IGF-1 LR3) is a peptide derivative of human insulin-like growth factor 1 (IGF-1; Item No. 33981) containing 13 additional amino acids at the N-terminus of IGF-1 as well as an arginine in place of glutamate at position 3 of IGF-1, a substitution that increases its half-life by reducing its interaction with IGF binding proteins (IGFBPs).1 It stimulates protein and DNA synthesis (EC50s = 0.19 and 1.8 nM, respectively) and prevents protein degradation in vitro (EC50 = 0.53 nM) to a greater degree than IGF-1. IGF-1 LR3 (278 µg/animal per day) increases body weight, muscle RNA content, and muscle protein synthesis in a rat model of diabetes.2 It reduces vessel stenosis and the necrotic core size of atherosclerotic plaques in a model of early atherosclerosis using ApoE-/- mice.3

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Francis, G.L., Ross, M., Ballard, F.J., et alNovel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. J. Mol. Endocrinol. 8(3), 213-223 (1992).

    2. Tomas, F.M., Knowles, S.E., Owens, P.C., et alInsulin-like growth factor-I and more potent variants restore growth of diabetic rats without inducing all characteristic insulin effects. Biochem. J. 291(Pt 3), 781-786 (1993).

    3. von der Thüsen, J.H., Borensztajn, K.S., Moimas, S., et alIGF-1 has plaque-stabilizing effects in atherosclerosis by altering vascular smooth muscle cell phenotype. Am. J. Pathol. 178(2), 924-934 (2011).