A TGF-β disrupting peptide
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Klotho-derived Peptide 1 (56-87) (human) (trifluoroacetate salt)

Item No. 38166

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Synonyms
  • KP1 (56-87)
Molecular Formula
C149H203N39O43 • XCF3COOH
Formula Weight
3228.4
Purity
≥95%
Formulation (Request formulation change)
A solid
Peptide Sequence
FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG-OH
Solubility(Learn about Variance in Solubility)
Water: Soluble
SMILES
[H]N[C@H](C(N[C@@H](CCC(N)=O)C(NCC(N[C@]([C@@H](C)O)([H])C(N[C@H](C(N1CCC[C@H]1C(N[C@H](C(NCC(N[C@H](C(N[C@@H](CC(C)C)C(N[C@H](C(N[C@H](C(N[C@@H](C(C)C)C(NCC(N[C@@H](CO)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@]([C@@H](C)O)([H])C(N[C@@H](CCC(O)=O)C(NCC(NCC(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@H](C(NCC(N[C@@H](CCCCN)C(NCC(O)=O)=O)=O)=O)CC2=CN=CN2)=O)=O)=O)CC3=CNC4=C3C=CC=C4)=O)=O)=O)=O)=O)=O)CC5=CC=C(O)C=C5)=O)C)=O)C)=O)=O)=O)=O)C)=O)CC6=CNC7=C6C=CC=C7)=O)=O)CC8=CC=CC=C8)=O)=O)CC(O)=O)=O)=O)CC9=CC=CC=C9)=O)=O)=O)=O)CC%10=CC=CC=C%10.FC(F)(C(O)=O)F
InChi Code
InChI=1S/C149H203N39O43.C2HF3O2/c1-75(2)54-101(180-141(223)102(56-83-28-15-11-16-29-83)171-118(200)69-163-135(217)107(62-122(205)206)183-145(227)110-37-25-53-188(110)149(231)108(58-84-30-17-12-18-31-84)184-147(229)125(80(8)190)185-120(202)71-161-132(214)96(42-47-111(152)193)174-130(212)92(151)55-82-26-13-10-14-27-82)140(222)181-105(60-87-64-158-94-35-22-20-33-91(87)94)139(221)168-79(7)129(211)186-124(76(3)4)146(228)164-70-119(201)173-109(73-189)144(226)169-77(5)127(209)167-78(6)128(210)179-103(57-85-38-40-89(192)41-39-85)142(224)177-100(45-50-114(155)196)138(220)187-126(81(9)191)148(230)178-97(46-51-121(203)204)133(215)160-66-115(197)159-67-116(198)172-104(59-86-63-157-93-34-21-19-32-90(86)93)143(225)176-98(43-48-112(153)194)136(218)175-99(44-49-113(154)195)137(219)182-106(61-88-65-156-74-166-88)134(216)162-68-117(199)170-95(36-23-24-52-150)131(213)165-72-123(207)208;3-2(4,5)1(6)7/h10-22,26-35,38-41,63-65,74-81,92,95-110,124-126,157-158,189-192H,23-25,36-37,42-62,66-73,150-151H2,1-9H3,(H2,152,193)(H2,153,194)(H2,154,195)(H2,155,196)(H,156,166)(H,159,197)(H,160,215)(H,161,214)(H,162,216)(H,163,217)(H,164,228)(H,165,213)(H,167,209)(H,168,221)(H,169,226)(H,170,199)(H,171,200)(H,172,198)(H,173,201)(H,174,212)(H,175,218)(H,176,225)(H,177,224)(H,178,230)(H,179,210)(H,180,223)(H,181,222)(H,182,219)(H,183,227)(H,184,229)(H,185,202)(H,186,211)(H,187,220)(H,203,204)(H,205,206)(H,207,208);(H,6,7)/t77-,78-,79-,80+,81+,92-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,124-,125-,126-;/m0./s1
InChi Key
JSGGJTPYPTZEGY-VEEFTMMJSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    500 µg

    $51

    Add

    1 mg

    $97

    Add

    5 mg

    $304

    Add

    10 mg

    $505

    Add
    Kinase Resource Center
    Discover Products & Resources for Kinase Research
    • Kinase inhibitors, screening libraries, assay kits, & more
    • Tools to study kinase signaling pathways:
      • Growth factor signaling
      • PI3K/Akt/mTOR
      • MAPKs (ERK, p38, & JNK)
      • JAK/STAT signaling
    • Articles, resources, & advice
    EXPLORE NOW
    Product Description

    Klotho-derived peptide 1 (KP1) (56-87) is a peptide derived from human Klotho protein, which has roles in disrupting TGF-β signaling.1 It binds to TGF-β receptor type 1 (TGFBR2), and TGF-β receptor type 2 (TGFBR2; Kds = 1.41 and 14.6 µM, respectively). Preincubation with KP1 (10 µg/ml) inhibits TGF-β-induced increases in fibronectin and α-smooth muscle actin (α-SMA) levels in NRK-49F rat fibroblasts. In vivo, KP1 (1 mg/kg per day) selectively localizes to damaged kidneys and reduces serum creatine and blood urea nitrogen levels, markers of kidney function, as well as reduces kidney fibrosis, in mouse models of unilateral ureteral obstruction (UUO) and unilateral ischemia-reperfusion injury-induced renal fibrosis.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Yuan, Q., Ren, Q., Li, L., et al. A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nat. Commun. 13(1), 438 (2022).