An antifibrotic TGFBR2 antagonist
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Klotho-derived Peptide 1 (trifluoroacetate salt)

Item No. 38166

Product Insert (PDF)Safety Data Sheet (SDS) (PDF)
Technical Information
Synonyms
  • Klotho (56-87) (human)
  • KP1
Molecular Formula
C149H203N39O43 • XCF3COOH
Formula Weight
3228.4
Purity
≥95%
Formulation (Request formulation change)
A solid
Peptide Sequence
FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG-OH
Solubility(Learn about Variance in Solubility)
Water: Soluble
SMILES
[H]N[C@H](C(N[C@@H](CCC(N)=O)C(NCC(N[C@]([C@@H](C)O)([H])C(N[C@H](C(N1CCC[C@H]1C(N[C@H](C(NCC(N[C@H](C(N[C@@H](CC(C)C)C(N[C@H](C(N[C@H](C(N[C@@H](C(C)C)C(NCC(N[C@@H](CO)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@]([C@@H](C)O)([H])C(N[C@@H](CCC(O)=O)C(NCC(NCC(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@H](C(NCC(N[C@@H](CCCCN)C(NCC(O)=O)=O)=O)=O)CC2=CN=CN2)=O)=O)=O)CC3=CNC4=C3C=CC=C4)=O)=O)=O)=O)=O)=O)CC5=CC=C(O)C=C5)=O)C)=O)C)=O)=O)=O)=O)C)=O)CC6=CNC7=C6C=CC=C7)=O)=O)CC8=CC=CC=C8)=O)=O)CC(O)=O)=O)=O)CC9=CC=CC=C9)=O)=O)=O)=O)CC%10=CC=CC=C%10.FC(F)(C(O)=O)F
InChi Code
InChI=1S/C149H203N39O43.C2HF3O2/c1-75(2)54-101(180-141(223)102(56-83-28-15-11-16-29-83)171-118(200)69-163-135(217)107(62-122(205)206)183-145(227)110-37-25-53-188(110)149(231)108(58-84-30-17-12-18-31-84)184-147(229)125(80(8)190)185-120(202)71-161-132(214)96(42-47-111(152)193)174-130(212)92(151)55-82-26-13-10-14-27-82)140(222)181-105(60-87-64-158-94-35-22-20-33-91(87)94)139(221)168-79(7)129(211)186-124(76(3)4)146(228)164-70-119(201)173-109(73-189)144(226)169-77(5)127(209)167-78(6)128(210)179-103(57-85-38-40-89(192)41-39-85)142(224)177-100(45-50-114(155)196)138(220)187-126(81(9)191)148(230)178-97(46-51-121(203)204)133(215)160-66-115(197)159-67-116(198)172-104(59-86-63-157-93-34-21-19-32-90(86)93)143(225)176-98(43-48-112(153)194)136(218)175-99(44-49-113(154)195)137(219)182-106(61-88-65-156-74-166-88)134(216)162-68-117(199)170-95(36-23-24-52-150)131(213)165-72-123(207)208;3-2(4,5)1(6)7/h10-22,26-35,38-41,63-65,74-81,92,95-110,124-126,157-158,189-192H,23-25,36-37,42-62,66-73,150-151H2,1-9H3,(H2,152,193)(H2,153,194)(H2,154,195)(H2,155,196)(H,156,166)(H,159,197)(H,160,215)(H,161,214)(H,162,216)(H,163,217)(H,164,228)(H,165,213)(H,167,209)(H,168,221)(H,169,226)(H,170,199)(H,171,200)(H,172,198)(H,173,201)(H,174,212)(H,175,218)(H,176,225)(H,177,224)(H,178,230)(H,179,210)(H,180,223)(H,181,222)(H,182,219)(H,183,227)(H,184,229)(H,185,202)(H,186,211)(H,187,220)(H,203,204)(H,205,206)(H,207,208);(H,6,7)/t77-,78-,79-,80+,81+,92-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,124-,125-,126-;/m0./s1
InChi Key
JSGGJTPYPTZEGY-VEEFTMMJSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

Download most recent Certificate of Analysis for this product

    500 µg

    $51

    Add

    1 mg

    $97

    Add

    5 mg

    $304

    Add

    10 mg

    $505

    Add
    Kinase Resource Center
    Discover Products & Resources for Kinase Research
    • Kinase inhibitors, screening libraries, assay kits, & more
    • Tools to study kinase signaling pathways:
      • Growth factor signaling
      • PI3K/Akt/mTOR
      • MAPKs (ERK, p38, & JNK)
      • JAK/STAT signaling
    • Articles, resources, & advice
    EXPLORE NOW
    Product Description

    Klotho-derived peptide 1 (KP1) is an antifibrotic peptide antagonist of TGF-β receptor type 2 (TGFBR2) that corresponds to amino acids 56-87 of human Klotho, an anti-aging protein involved in TGF-β, Wnt, and FGF2 signaling.1 It binds to TGFBR2 (Kd = 1.41 µM) and inhibits TGF-β-induced increases in fibronectin and α-smooth muscle actin (α-SMA) levels in NRK-49F rat fibroblasts. In vivo, KP1 (1 mg/kg per day) selectively localizes to damaged kidneys and reduces fibrosis and serum creatinine and blood urea nitrogen (BUN) levels in mouse models of renal fibrosis. It also prevents severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) nucleocapsid protein-induced aggravation of acute kidney injury, reduces bile duct ligation-induced cholestatic fibrosis, and decreases acute liver injury-induced hepatic fibrosis in mice.2,3 KP1 (1 mg/kg) preserves erectile function and decreases corporal apoptosis and oxidative damage in a rat model of bilateral cavernous nerve injury.4

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Yuan, Q., Ren, Q., Li, L., et al. A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nat. Commun. 13(1), 438 (2022).

    2. Xu, J., Lin, E., Hong, X., et al. Klotho-derived peptide KP1 ameliorates SARS-CoV-2-associated acute kidney injury. Front. Pharmacol. 14, 1333389 (2024).

    3. Tan, H., Huang, W., Luo, H., et al. Klotho-derived peptide 1 ameliorates hepatic fibrosis induced by αKlotho deficiency and liver injury. Int. J. Biol. Sci. 22(3), 1425-1439 (2026).

    4. Xi, Y., Han, G., Li, X., et al. Klotho-derived peptide preserves erectile function by limiting fibrosis, oxidative stress, and apoptosis of penile smooth muscle cells in cavernous nerve injured-rats through suppression of the TGF-β1/TGF-β type II receptor signaling. Eur. J. Pharmacol. 1022, 178849 (2026).