A peptide nAChR antagonist
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

RVG Peptide (trifluoroacetate salt)

Item No. 41606

Technical Information
Formal Name
L-tyrosyl-L-threonyl-L-isoleucyl-L-tryptophyl-L-methionyl-L-prolyl-L-α-glutamyl-L-asparaginyl-L-prolyl-L-arginyl-L-prolylglycyl-L-threonyl-L-prolyl-L-cysteinyl-L-α-aspartyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-asparaginyl-L-seryl-L-arginylglycyl-L-lysyl-L-arginyl-L-alanyl-L-seryl-L-asparaginyl-glycine, trifluoroacetate salt
Synonyms
  • Rabies Virus Glycoprotein
  • Rabies Virus Glycoprotein 29
  • RABV-G
  • RVG29
Molecular Formula
C141H217N43O43S2 • XCF3COOH
Formula Weight
Purity
≥98%
A solid
Peptide Sequence
YTIWMPENPRPGTPCDIFTNSRGKRASNG-OH
DMSO: Soluble: ≥10 mg/mlPBS (pH 7.2): Soluble: ≥10 mg/ml
SMILES
O=C(N[C@]([C@H](O[H])C)([H])C(N[C@@](C(N[C@@H](CC1=CN([H])C2=C1C=CC=C2)C(N[C@@H](CCSC)C(N3CCC[C@H]3C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(N[H])=O)C(N4CCC[C@H]4C(N[C@@H](CCC/N=C(N[H])/N)C(N5CCC[C@H]5C(NCC(N[C@]([C@H](O[H])C)([H])C(N6CCC[C@H]6C(N[C@@H](CS[H])C(N[C@@H](CC(O)=O)C(N[C@@](C(N[C@H](C(N[C@]([C@H](O[H])C)([H])C(N[C@@H](CC(N[H])=O)C(N[C@@H](CO[H])C(N[C@@H](CCC/N=C(N[H])/N)C(NCC(N[C@@H](CCCCN[H])C(N[C@@H](CCC/N=C(N[H])/N)C(N[C@H](C(N[C@@H](CO[H])C(N[C@@H](CC(N[H])=O)C(NCC(O)=O)=O)=O)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)CC7=CC=CC=C7)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)([H])[C@@H](C)CC)=O)[C@H](CC8=CC=C(O[H])C=C8)N[H].FC(F)(C(O)=O)F
InChi Code
InChI=1S/C141H217N43O43S2.C2HF3O2/c1-10-68(3)108(131(220)169-87(55-74-26-13-12-14-27-74)122(211)180-110(71(6)187)133(222)171-90(58-101(145)192)121(210)174-94(66-186)124(213)162-81(31-19-46-153-139(147)148)115(204)157-62-103(194)161-82(30-17-18-45-142)118(207)163-83(32-20-47-154-140(149)150)117(206)160-70(5)113(202)173-93(65-185)125(214)167-89(57-100(144)191)116(205)159-64-107(200)201)177-123(212)91(60-106(198)199)168-126(215)95(67-228)175-130(219)99-37-25-52-184(99)138(227)112(73(8)189)176-104(195)63-158-127(216)96-34-22-49-181(96)135(224)85(33-21-48-155-141(151)152)166-129(218)98-36-24-51-183(98)137(226)92(59-102(146)193)172-119(208)84(42-43-105(196)197)164-128(217)97-35-23-50-182(97)136(225)86(44-53-229-9)165-120(209)88(56-76-61-156-80-29-16-15-28-78(76)80)170-132(221)109(69(4)11-2)178-134(223)111(72(7)188)179-114(203)79(143)54-75-38-40-77(190)41-39-75;3-2(4,5)1(6)7/h12-16,26-29,38-41,61,68-73,79,81-99,108-112,156,185-190,228H,10-11,17-25,30-37,42-60,62-67,142-143H2,1-9H3,(H2,144,191)(H2,145,192)(H2,146,193)(H,157,204)(H,158,216)(H,159,205)(H,160,206)(H,161,194)(H,162,213)(H,163,207)(H,164,217)(H,165,209)(H,166,218)(H,167,214)(H,168,215)(H,169,220)(H,170,221)(H,171,222)(H,172,208)(H,173,202)(H,174,210)(H,175,219)(H,176,195)(H,177,212)(H,178,223)(H,179,203)(H,180,211)(H,196,197)(H,198,199)(H,200,201)(H4,147,148,153)(H4,149,150,154)(H4,151,152,155);(H,6,7)/t68-,69-,70-,71+,72+,73+,79-,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,108-,109-,110-,111-,112-;/m0./s1
InChi Key
DLLXHIRYQVJIQN-HHCNHDPZSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Wet ice in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Add

    Cayman Chemical
    Visit Our Lipid Nanoparticle Resource Center for Additional Tools & Resources
    EXPLORE NOW
    Product Description

    Rabies virus glycoprotein (RVG) peptide is a nicotinic acetylcholine receptor (nAChR) antagonist (IC50 = 2.5 µM for the human receptor).1 Lipid nanoparticles (LNPs) conjugated to RVG peptide selectively traffic to the brain over the lungs and liver in rats.2 LNPs conjugated to RVG peptide and encapsulating the iron chelator and prolyl hydroxylase inhibitor deferoxamine (DFO; Item No. 14595) reduce iron levels in the striatum and substantia nigra, as well as decrease levels of reactive oxygen species (ROS) and malondialdehyde (MDA) and increase levels of superoxide dismutase (SOD) in the substantia nigra in a mouse model of MPTP-induced Parkinson's disease. RVG-containing and DFO-encapsulating LNPs also increase the latency to fall in the rotarod test in the same model.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Lentz, T.L., Hawrot, E., and Wilson, P.T. Synthetic peptides corresponding to sequences of snake venom neurotoxins and rabies virus glycoprotein bind to the nicotinic acetylcholine receptor. Proteins 2(4), 298-307 (1987).

    2. You, L., Wang, J., Liu, T., et al. Correction to targeted brain delivery of rabies virus glycoprotein 29-modified deferoxamine-loaded nanoparticles reverses functional deficits in Parkinsonian mice. ACS Nano 16(11), 19605 (2022).