A GLP-1R agonist
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Exendin-4 amide (acetate)

Item No. 11096

Technical Information
CAS Number
914454-01-6
Synonyms
  • Exenatide Acetate
Molecular Formula
C184H282N50O60S • C2H4O2
Formula Weight
Purity
≥95%
A crystalline solid
Peptide Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
PBS (pH 7.2): 3 mg/ml
SMILES
NC([C@H](CO)NC([C@@H]1CCCN1C([C@@H]2CCCN2C([C@@H]3CCCN3C([C@@H](NC(CNC([C@H](CO)NC([C@H](CO)NC([C@@H]4CCCN4C(CNC(CNC([C@H](CC(N)=O)NC([C@H](CCCCN)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](CCC(O)=O)NC([C@@]([C@H](CC)C)([H])NC([C@@H](NC([C@H](CC(C)C)NC([C@H](CCCNC(N)=N)NC([C@H](C(C)C)NC([C@@H](NC([C@H](CCC(O)=O)NC([C@H](CCC(O)=O)NC([C@H](CCC(O)=O)NC([C@@H](NC([C@H](CCC(N)=O)NC([C@H](CCCCN)NC([C@H](CO)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](CO)NC([C@@]([C@@H](C)O)([H])NC([C@@H](NC([C@@]([C@@H](C)O)([H])NC(CNC([C@H](CCC(O)=O)NC(CNC([C@@H](N[H])CC5=CN=CN5)=O)=O)=O)=O)=O)CC6=CC=CC=C6)=O)=O)=O)CC(O)=O)=O)=O)=O)=O)=O)CCSC)=O)=O)=O)=O)C)=O)=O)=O)=O)CC7=CC=CC=C7)=O)=O)=O)CC8=CNC9=C8C=CC=C9)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)C)=O)=O)=O)=O)=O.OC(C)=O
InChi Code
InChI=1S/C184H282N50O60S.C2H4O2/c1-16-94(10)147(178(289)213-114(52-58-144(257)258)163(274)218-121(73-101-77-195-105-39-24-23-38-103(101)105)168(279)215-116(68-90(2)3)165(276)205-107(41-26-28-61-186)158(269)219-122(75-134(189)243)154(265)198-79-135(244)196-83-139(248)231-63-30-43-129(231)175(286)225-127(87-238)174(285)223-125(85-236)155(266)200-80-136(245)202-96(12)181(292)233-65-32-45-131(233)183(294)234-66-33-46-132(234)182(293)232-64-31-44-130(232)176(287)222-124(84-235)150(190)261)229-170(281)119(71-99-34-19-17-20-35-99)217-166(277)117(69-91(4)5)214-159(270)108(42-29-62-194-184(191)192)212-177(288)146(93(8)9)228-151(262)95(11)203-156(267)111(49-55-141(251)252)208-161(272)112(50-56-142(253)254)209-162(273)113(51-57-143(255)256)210-164(275)115(59-67-295-15)211-160(271)110(47-53-133(188)242)207-157(268)106(40-25-27-60-185)206-172(283)126(86-237)224-167(278)118(70-92(6)7)216-169(280)123(76-145(259)260)220-173(284)128(88-239)226-180(291)149(98(14)241)230-171(282)120(72-100-36-21-18-22-37-100)221-179(290)148(97(13)240)227-138(247)82-199-153(264)109(48-54-140(249)250)204-137(246)81-197-152(263)104(187)74-102-78-193-89-201-102;1-2(3)4/h17-24,34-39,77-78,89-98,104,106-132,146-149,195,235-241H,16,25-33,40-76,79-88,185-187H2,1-15H3,(H2,188,242)(H2,189,243)(H2,190,261)(H,193,201)(H,196,244)(H,197,263)(H,198,265)(H,199,264)(H,200,266)(H,202,245)(H,203,267)(H,204,246)(H,205,276)(H,206,283)(H,207,268)(H,208,272)(H,209,273)(H,210,275)(H,211,271)(H,212,288)(H,213,289)(H,214,270)(H,215,279)(H,216,280)(H,217,277)(H,218,274)(H,219,269)(H,220,284)(H,221,290)(H,222,287)(H,223,285)(H,224,278)(H,225,286)(H,226,291)(H,227,247)(H,228,262)(H,229,281)(H,230,282)(H,249,250)(H,251,252)(H,253,254)(H,255,256)(H,257,258)(H,259,260)(H4,191,192,194);1H3,(H,3,4)/t94-,95-,96-,97+,98+,104-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,146-,147-,148-,149-;/m0./s1
InChi Key
YEAXWAGAAYUUBX-JVTOQCAZSA-N
Origin
Animal/Rabbit
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Exendin-4 amide is a peptide hormone produced in the salivary gland of the Gila monster and an agonist of the glucagon-like peptide 1 receptor (GLP-1R; IC50 = 3.5 nM).1,2 Radiolabeled exendin-4 amide localizes to the pancreas, kidneys, and bladder in a porcine model of diabetes induced by streptozotocin (Item No. 13104).3 Exendin-4 amide (10 nmol/kg) improves motor performance in the rotarod test in an mouse model of Parkinson’s disease induced by MPTP.4 It reduces MPTP-induced loss of dopaminergic neurons in the substantia nigra in the same model. Formulations containing exendin-4 amide have been used in the treatment of type 2 diabetes mellitus.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Clardy, S.M., Mohan, J.F., Vinegoni, C., et alRapid, high efficiency isolation of pancreatic β-cells. Sci. Rep. 5, 13681 (2015).

    2. Doyle, M.E., Theodorakis, M.J., Holloway, H.W., et alThe importance of the nine-amino acid C-terminal sequence of exendin-4 for binding to the GLP-1 receptor and for biological activity. Regul. Pept. 114(2-3), 153-158 (2003).

    3. Nalin, L., Selvaraju, R.K., Velikyan, I., et alPositron emission tomography imaging of the glucagon-like peptide-1 receptor in healthy and streptozotocin-induced diabetic pigs. Eur. J. Nucl. Med. Mol. Imaging 41(9), 1800-1810 (2014).

    4. Zhang, L., Zhang, L., Li, Y., et alThe novel dual GLP-1/GIP receptor agonist DA-CH5 is superior to single GLP-1 receptor agonists in the MPTP model of Parkinson’s disease. J. Parkinsons Dis. 10(2), 523-542 (2020).