A peptide fragment of GIP and a GIP receptor antagonist
Technical Support & Resources

Information provided in the product description is from published literature. Due to the nature of scientific experimentation, your results (e.g., selectivity and effective concentrations) or specific application for this product may differ. If you have questions about how this product fits your application, please contact our technical support staff.

Visit our FAQ

Contact Us

Toll Free Phone (USA and Canada Only): (888) 526-5351
Direct Phone: (734) 975-3888

Request Technical Support

Technical Support Request

To streamline the process attach the appropriate questionnaire to your inquiry.

Download IHC QuestionnaireDownload WB Questionnaire

View Our Privacy Statement for details on how we use and protect your data. In addition, this site is protected by hCaptcha and its Privacy Policy and Terms of Service apply.

Glucose-dependent Insulinotropic Polypeptide (3-42) (human) (trifluoroacetate salt)

Item No. 36908

Technical Information
Formal Name
L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-histidyl-L-glutaminyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysylglycyl-L-lysyl-L-lysyl-L-asparaginyl-L-α-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-glutamine, trifluoroacetate salt
Synonyms
  • Gastric Inhibitory Peptide 1 (3-42)
  • GIP-1 (3-42)
Molecular Formula
C214H324N58O63S • XCF3COOH
Formula Weight
Purity
≥90%
A solid
Peptide Sequence
EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH
Water: Soluble
SMILES
O=C(O)CC[C@H](N[H])C(NCC(N[C@]([C@H](O)C)([H])C(N[C@H](C(N[C@@](C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](CC1=CC=C(O)C=C1)C(N[C@@H](CO)C(N[C@@](C(N[C@H](C(N[C@@H](CCSC)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCCN[H])C(N[C@@](C(N[C@@H](CC2=CNC=N2)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CC3=CNC4=C3C=CC=C4)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN[H])C(NCC(N[C@@H](CCCCN[H])C(N[C@@H](CCCCN[H])C(N[C@@H](CC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC5=CNC6=C5C=CC=C6)C(N[C@@H](CCCCN[H])C(N[C@@H](CC7=CNC=N7)C(N[C@@H](CC(N)=O)C(N[C@@](C(N[C@]([C@H](O)C)([H])C(N[C@@H](CCC(N)=O)C(O)=O)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)C)=O)CC(C)C)=O)CC(C)C)=O)=O)=O)=O)CC8=CC=CC=C8)=O)=O)=O)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)C)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)=O)([H])[C@@H](C)CC)=O)CC9=CC=CC=C9)=O)=O)=O.OC(C(F)(F)F)=O
InChi Code
InChI=1S/C214H324N58O63S.C2HF3O2/c1-20-107(11)171(271-206(326)155(101-274)264-191(311)140(82-117-57-59-122(277)60-58-117)250-200(320)153(93-169(295)296)260-205(325)154(100-273)265-210(330)173(109(13)22-3)269-203(323)142(81-116-46-28-25-29-47-116)261-212(332)175(113(17)275)266-164(286)99-232-179(299)125(220)61-70-165(287)288)208(328)237-112(16)178(298)240-136(71-77-336-19)187(307)258-150(90-166(289)290)198(318)244-132(56-38-43-76-219)188(308)268-172(108(12)21-2)209(329)262-146(86-121-97-229-103-235-121)194(314)246-134(63-67-157(222)279)185(305)245-135(64-68-158(223)280)186(306)257-151(91-167(291)292)199(319)251-141(80-115-44-26-24-27-45-115)202(322)267-170(106(9)10)207(327)263-148(88-161(226)283)197(317)252-144(84-119-95-231-127-51-33-31-49-124(119)127)193(313)249-139(79-105(7)8)190(310)248-138(78-104(5)6)189(309)236-111(15)177(297)239-133(62-66-156(221)278)184(304)241-128(52-34-39-72-215)180(300)233-98-163(285)238-129(53-35-40-73-216)181(301)242-130(54-36-41-74-217)183(303)255-147(87-160(225)282)196(316)259-152(92-168(293)294)201(321)253-143(83-118-94-230-126-50-32-30-48-123(118)126)192(312)243-131(55-37-42-75-218)182(302)254-145(85-120-96-228-102-234-120)195(315)256-149(89-162(227)284)204(324)270-174(110(14)23-4)211(331)272-176(114(18)276)213(333)247-137(214(334)335)65-69-159(224)281;3-2(4,5)1(6)7/h24-33,44-51,57-60,94-97,102-114,125,128-155,170-176,230-231,273-277H,20-23,34-43,52-56,61-93,98-101,215-220H2,1-19H3,(H2,221,278)(H2,222,279)(H2,223,280)(H2,224,281)(H2,225,282)(H2,226,283)(H2,227,284)(H,228,234)(H,229,235)(H,232,299)(H,233,300)(H,236,309)(H,237,328)(H,238,285)(H,239,297)(H,240,298)(H,241,304)(H,242,301)(H,243,312)(H,244,318)(H,245,305)(H,246,314)(H,247,333)(H,248,310)(H,249,313)(H,250,320)(H,251,319)(H,252,317)(H,253,321)(H,254,302)(H,255,303)(H,256,315)(H,257,306)(H,258,307)(H,259,316)(H,260,325)(H,261,332)(H,262,329)(H,263,327)(H,264,311)(H,265,330)(H,266,286)(H,267,322)(H,268,308)(H,269,323)(H,270,324)(H,271,326)(H,272,331)(H,287,288)(H,289,290)(H,29
InChi Key
PCMPOMOCIGXLLS-UODVGNHTSA-N
Shipping & Storage Information
Storage
-20°C
Shipping
Room temperature in continental US; may vary elsewhere
Recommended Products

Certificates of Analysis & Batch Specific Data

Provide batch numbers separated by commas to download or request available product inserts, QC sheets, certificates of analysis, data packs, and GC-MS data.

    Add

    Add

    Add

    Add

    Cayman Chemical
    Explore Obesity & Metabolic Disease Resources

    Discover high-quality research tools to investigate GLP-1 mechanisms and next-generation metabolic targets.

    OBESITY RESEARCH SOLUTIONS
    Product Description

    Gastric inhibitory peptide 1 (GIP-1) (3-42) is a peptide fragment of the incretin hormone GIP (Item No. 25004) and a GIP receptor antagonist.1 It is formed from GIP by serum dipeptidyl peptidase 4 (DDP-4). GIP-1 (3-42) (100 nM) reduces insulin secretion from BRIN-BD11 pancreatic cells. It increases plasma glucose levels and decreases plasma insulin levels in an ob/ob mouse model of diabetes when administered at a dose of 25 nmol/kg.

    WARNING This product is not for human or veterinary use.

    References & Product Citations
    Product Description References

    1. Gault, V.A., Parker, J.C., Harriott, P., et al. Evidence that the major degradation product of glucose-dependent insulinotropic polypeptide, GIP(3-42), is a GIP receptor antagonist in vivo. J. Endocrinol. 175(2), 525-533 (2002).